Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G4PG35

Protein Details
Accession A0A0G4PG35    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
147-169EAEAPKSKTQMKKEKRGSTVKYRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, extr 4, plas 3, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008506  SND2/TMEM208  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
Pfam View protein in Pfam  
PF05620  TMEM208_SND2  
Amino Acid Sequences MKATKSLATRNGAVLSRTHLISAALHLLFLLLHFVFQRPRSLKPYFFLAVPTLAVEYYLDRMGRPRYHEDGSLRSAGEDLNATGLTEYMWDVLYWTQGCIVAVCLFDDRAWWLWIVIPLYSVYAAYTTIMGVKKGFAGMGGGDAGQEAEAPKSKTQMKKEKRGSTVKYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.27
3 0.25
4 0.23
5 0.21
6 0.17
7 0.16
8 0.16
9 0.17
10 0.16
11 0.13
12 0.13
13 0.12
14 0.12
15 0.1
16 0.1
17 0.1
18 0.05
19 0.06
20 0.07
21 0.09
22 0.13
23 0.14
24 0.23
25 0.23
26 0.28
27 0.34
28 0.38
29 0.39
30 0.38
31 0.43
32 0.35
33 0.33
34 0.3
35 0.25
36 0.21
37 0.18
38 0.16
39 0.1
40 0.08
41 0.08
42 0.07
43 0.06
44 0.07
45 0.08
46 0.08
47 0.08
48 0.11
49 0.16
50 0.18
51 0.22
52 0.26
53 0.29
54 0.31
55 0.34
56 0.34
57 0.33
58 0.33
59 0.3
60 0.24
61 0.19
62 0.18
63 0.14
64 0.12
65 0.08
66 0.05
67 0.05
68 0.05
69 0.05
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.03
76 0.04
77 0.04
78 0.04
79 0.05
80 0.06
81 0.06
82 0.06
83 0.06
84 0.06
85 0.07
86 0.06
87 0.07
88 0.06
89 0.06
90 0.07
91 0.07
92 0.07
93 0.07
94 0.07
95 0.08
96 0.08
97 0.09
98 0.09
99 0.08
100 0.09
101 0.12
102 0.12
103 0.1
104 0.09
105 0.09
106 0.09
107 0.09
108 0.08
109 0.06
110 0.05
111 0.06
112 0.05
113 0.05
114 0.05
115 0.09
116 0.09
117 0.1
118 0.1
119 0.1
120 0.1
121 0.1
122 0.1
123 0.07
124 0.07
125 0.06
126 0.07
127 0.07
128 0.06
129 0.06
130 0.06
131 0.06
132 0.05
133 0.05
134 0.05
135 0.07
136 0.11
137 0.14
138 0.15
139 0.21
140 0.29
141 0.37
142 0.46
143 0.55
144 0.61
145 0.69
146 0.79
147 0.83
148 0.84
149 0.86