Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G4PVR2

Protein Details
Accession A0A0G4PVR2    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MRKVLRRKRRNKCRSDNHAANPTAHydrophilic
NLS Segment(s)
PositionSequence
6-10RRKRR
Subcellular Location(s) nucl 15.5, mito_nucl 12.5, mito 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036736  ACP-like_sf  
IPR009081  PP-bd_ACP  
Gene Ontology GO:0016020  C:membrane  
GO:1901576  P:organic substance biosynthetic process  
Pfam View protein in Pfam  
PF00550  PP-binding  
Amino Acid Sequences MRKVLRRKRRNKCRSDNHAANPTASNTKCWSLTGRKIRLKQKFPQVFALAQNAIDTNDNLFTEGGDSISAMQLLNLARRVDPTSTTTDFLLHNIILLFWGIFYSHLVEIGVTIWFYPD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.93
3 0.91
4 0.87
5 0.85
6 0.75
7 0.66
8 0.57
9 0.49
10 0.46
11 0.37
12 0.32
13 0.26
14 0.27
15 0.26
16 0.26
17 0.28
18 0.28
19 0.37
20 0.45
21 0.51
22 0.56
23 0.63
24 0.71
25 0.75
26 0.74
27 0.72
28 0.73
29 0.71
30 0.66
31 0.64
32 0.57
33 0.5
34 0.45
35 0.4
36 0.3
37 0.22
38 0.2
39 0.14
40 0.12
41 0.1
42 0.09
43 0.06
44 0.07
45 0.06
46 0.07
47 0.07
48 0.06
49 0.06
50 0.06
51 0.05
52 0.04
53 0.05
54 0.04
55 0.04
56 0.05
57 0.04
58 0.03
59 0.05
60 0.06
61 0.08
62 0.1
63 0.11
64 0.11
65 0.13
66 0.15
67 0.14
68 0.16
69 0.17
70 0.21
71 0.22
72 0.23
73 0.22
74 0.21
75 0.21
76 0.2
77 0.19
78 0.12
79 0.11
80 0.1
81 0.09
82 0.08
83 0.08
84 0.07
85 0.04
86 0.05
87 0.04
88 0.05
89 0.06
90 0.09
91 0.08
92 0.09
93 0.09
94 0.09
95 0.09
96 0.09
97 0.09
98 0.06