Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0G4NWN3

Protein Details
Accession A0A0G4NWN3    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
6-34QSQKNFGESKEKKKIKKKPKAPPTTRTGTHydrophilic
NLS Segment(s)
PositionSequence
15-38KEKKKIKKKPKAPPTTRTGTRMRK
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
Amino Acid Sequences MYHFLQSQKNFGESKEKKKIKKKPKAPPTTRTGTRMRKVTPKNNVLRGPLLYSRSTAPLVHPLPSGLIARSPDRHCQGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.52
3 0.57
4 0.63
5 0.72
6 0.81
7 0.81
8 0.86
9 0.86
10 0.86
11 0.9
12 0.92
13 0.89
14 0.86
15 0.82
16 0.8
17 0.73
18 0.67
19 0.65
20 0.62
21 0.59
22 0.57
23 0.53
24 0.53
25 0.57
26 0.6
27 0.6
28 0.6
29 0.61
30 0.63
31 0.62
32 0.55
33 0.5
34 0.43
35 0.37
36 0.32
37 0.29
38 0.22
39 0.21
40 0.2
41 0.2
42 0.21
43 0.17
44 0.16
45 0.22
46 0.23
47 0.23
48 0.22
49 0.2
50 0.19
51 0.21
52 0.21
53 0.13
54 0.15
55 0.16
56 0.2
57 0.26
58 0.29
59 0.35