Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G4P4J4

Protein Details
Accession A0A0G4P4J4    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
77-96LCNACGLRWSKKEKKRQESAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 7, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000679  Znf_GATA  
IPR013088  Znf_NHR/GATA  
Gene Ontology GO:0043565  F:sequence-specific DNA binding  
GO:0008270  F:zinc ion binding  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF00320  GATA  
PROSITE View protein in PROSITE  
PS00344  GATA_ZN_FINGER_1  
PS50114  GATA_ZN_FINGER_2  
CDD cd00202  ZnF_GATA  
Amino Acid Sequences MTGLNYAEGERSQGLSTGVSLGRLVHCDIDITTTADQERNAQEGDRRKRLKAQHVCSDCGTADSPEWRKGPNGPKTLCNACGLRWSKKEKKRQESA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.12
4 0.12
5 0.12
6 0.1
7 0.1
8 0.1
9 0.1
10 0.12
11 0.12
12 0.09
13 0.09
14 0.1
15 0.09
16 0.1
17 0.11
18 0.11
19 0.11
20 0.11
21 0.12
22 0.12
23 0.12
24 0.13
25 0.13
26 0.12
27 0.13
28 0.12
29 0.16
30 0.25
31 0.31
32 0.37
33 0.38
34 0.38
35 0.44
36 0.5
37 0.56
38 0.57
39 0.56
40 0.57
41 0.58
42 0.59
43 0.53
44 0.49
45 0.38
46 0.3
47 0.24
48 0.15
49 0.13
50 0.17
51 0.19
52 0.22
53 0.23
54 0.22
55 0.23
56 0.3
57 0.39
58 0.42
59 0.47
60 0.45
61 0.48
62 0.54
63 0.56
64 0.5
65 0.46
66 0.38
67 0.3
68 0.37
69 0.39
70 0.4
71 0.43
72 0.51
73 0.57
74 0.65
75 0.75
76 0.77