Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G4P3Q9

Protein Details
Accession A0A0G4P3Q9    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
27-48ERDYRKEKRTRMRVGNVRKDEKBasic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 12.333, mito_nucl 11.666, cyto 4
Family & Domain DBs
Amino Acid Sequences MFYPASAGQTTPYPSNSLHIKSWWEEERDYRKEKRTRMRVGNVRKDEKGQVLKDLPRTW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.22
3 0.25
4 0.25
5 0.24
6 0.23
7 0.25
8 0.24
9 0.29
10 0.29
11 0.26
12 0.24
13 0.3
14 0.36
15 0.38
16 0.42
17 0.41
18 0.47
19 0.51
20 0.57
21 0.61
22 0.63
23 0.67
24 0.71
25 0.76
26 0.77
27 0.81
28 0.84
29 0.82
30 0.77
31 0.7
32 0.65
33 0.58
34 0.57
35 0.55
36 0.46
37 0.45
38 0.46
39 0.49