Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G4NUQ6

Protein Details
Accession A0A0G4NUQ6    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
159-184TENGAQKKASRSKKEKIKDAVNKVIPHydrophilic
NLS Segment(s)
PositionSequence
165-177KKASRSKKEKIKD
Subcellular Location(s) nucl 18, cyto_nucl 13.333, mito_nucl 10.499, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MASSSAPVQSAASDRDTAQLVKEHSHAFQNRLNTTQTDSPPVSETTKSDIDTDQLKAEAGLEAPKPAPETKPPVTEPTEPAPGSVPIARQSQISVGPKDETVAGEKRDIDSTVTPTPALAEDEEQQRPEPSDEPDTKKLKTDEKPVSDPNGTAAAPSNTENGAQKKASRSKKEKIKDAVNKVIPGDGIGSRTRSRTKGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.21
4 0.2
5 0.19
6 0.21
7 0.2
8 0.21
9 0.24
10 0.23
11 0.23
12 0.31
13 0.32
14 0.32
15 0.34
16 0.38
17 0.37
18 0.38
19 0.39
20 0.31
21 0.34
22 0.36
23 0.34
24 0.32
25 0.31
26 0.3
27 0.3
28 0.31
29 0.28
30 0.23
31 0.23
32 0.22
33 0.24
34 0.24
35 0.23
36 0.21
37 0.2
38 0.22
39 0.21
40 0.17
41 0.14
42 0.13
43 0.12
44 0.12
45 0.1
46 0.08
47 0.09
48 0.08
49 0.09
50 0.09
51 0.1
52 0.12
53 0.13
54 0.14
55 0.16
56 0.24
57 0.26
58 0.3
59 0.31
60 0.34
61 0.37
62 0.37
63 0.36
64 0.33
65 0.35
66 0.3
67 0.28
68 0.25
69 0.21
70 0.2
71 0.17
72 0.14
73 0.12
74 0.14
75 0.14
76 0.13
77 0.13
78 0.13
79 0.16
80 0.19
81 0.16
82 0.16
83 0.16
84 0.16
85 0.16
86 0.15
87 0.1
88 0.11
89 0.12
90 0.12
91 0.13
92 0.13
93 0.14
94 0.14
95 0.14
96 0.13
97 0.11
98 0.15
99 0.15
100 0.15
101 0.14
102 0.13
103 0.13
104 0.12
105 0.11
106 0.07
107 0.08
108 0.1
109 0.14
110 0.15
111 0.16
112 0.16
113 0.15
114 0.17
115 0.17
116 0.16
117 0.15
118 0.22
119 0.27
120 0.33
121 0.4
122 0.42
123 0.41
124 0.44
125 0.44
126 0.45
127 0.45
128 0.48
129 0.49
130 0.52
131 0.57
132 0.55
133 0.57
134 0.49
135 0.44
136 0.36
137 0.31
138 0.24
139 0.19
140 0.19
141 0.14
142 0.15
143 0.16
144 0.15
145 0.12
146 0.14
147 0.18
148 0.19
149 0.22
150 0.22
151 0.25
152 0.33
153 0.42
154 0.5
155 0.56
156 0.61
157 0.67
158 0.76
159 0.81
160 0.82
161 0.81
162 0.82
163 0.81
164 0.82
165 0.82
166 0.77
167 0.7
168 0.61
169 0.54
170 0.43
171 0.33
172 0.27
173 0.18
174 0.17
175 0.17
176 0.21
177 0.21
178 0.27
179 0.32