Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G4PLY2

Protein Details
Accession A0A0G4PLY2   
Localization Confidence High
Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
95-117ASWPSRRKRSLRGKVKPDERQSPHydrophilic
NLS Segment(s)
PositionSequence
43-73IRRSILKSRERTSPRRDRPEDRPLKRVRFKP
95-111ASWPSRRKRSLRGKVKP
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MTLSDKPSNESRMHTLLADFKTSIEASDRARVSVEPTVSPQKIRRSILKSRERTSPRRDRPEDRPLKRVRFKPASGVPLEEFVPSGARAAEKSIASWPSRRKRSLRGKVKPDERQSPHNGGNSPQSMKNKDHIEALGTEVKSLKRELETMRSCRSDARSSERDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.3
3 0.32
4 0.31
5 0.29
6 0.23
7 0.2
8 0.22
9 0.21
10 0.19
11 0.16
12 0.17
13 0.17
14 0.25
15 0.25
16 0.22
17 0.23
18 0.23
19 0.23
20 0.25
21 0.24
22 0.17
23 0.21
24 0.29
25 0.29
26 0.32
27 0.33
28 0.38
29 0.43
30 0.45
31 0.49
32 0.49
33 0.57
34 0.64
35 0.69
36 0.67
37 0.63
38 0.69
39 0.68
40 0.69
41 0.7
42 0.71
43 0.7
44 0.74
45 0.77
46 0.74
47 0.75
48 0.78
49 0.79
50 0.72
51 0.71
52 0.68
53 0.71
54 0.72
55 0.69
56 0.68
57 0.64
58 0.61
59 0.59
60 0.56
61 0.51
62 0.44
63 0.41
64 0.32
65 0.26
66 0.26
67 0.18
68 0.13
69 0.09
70 0.09
71 0.06
72 0.06
73 0.05
74 0.05
75 0.05
76 0.06
77 0.09
78 0.08
79 0.09
80 0.11
81 0.14
82 0.15
83 0.2
84 0.28
85 0.35
86 0.42
87 0.47
88 0.48
89 0.56
90 0.66
91 0.72
92 0.74
93 0.74
94 0.77
95 0.81
96 0.86
97 0.84
98 0.8
99 0.79
100 0.73
101 0.7
102 0.67
103 0.65
104 0.6
105 0.55
106 0.49
107 0.41
108 0.43
109 0.4
110 0.36
111 0.35
112 0.37
113 0.37
114 0.38
115 0.43
116 0.41
117 0.38
118 0.38
119 0.33
120 0.3
121 0.26
122 0.28
123 0.27
124 0.23
125 0.22
126 0.22
127 0.22
128 0.22
129 0.22
130 0.21
131 0.17
132 0.22
133 0.26
134 0.33
135 0.4
136 0.44
137 0.5
138 0.49
139 0.48
140 0.49
141 0.51
142 0.48
143 0.46
144 0.5