Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G4P0R2

Protein Details
Accession A0A0G4P0R2    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
154-176VHQKKEGAPQPSKKTKKKSKDEABasic
NLS Segment(s)
PositionSequence
158-173KEGAPQPSKKTKKKSK
Subcellular Location(s) nucl 13.5, cyto_nucl 12.833, cyto 11, cyto_mito 6.333
Family & Domain DBs
Amino Acid Sequences MSVPLTKVDSAIAGLSISDEKPEIEKDVKAKSHRRASSTVEGIWNIKDLEEQKKDLELPIETQKTGWKLNTSPSTIEDKDILKMFLVTPPVKKIDLHFPLGLEVTARNLKGVTIKDALDAIYKQFKKKADDELDKPYLAGFEWDKEECWTRLVVHQKKEGAPQPSKKTKKKSKDEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.09
4 0.08
5 0.08
6 0.09
7 0.09
8 0.11
9 0.13
10 0.16
11 0.17
12 0.2
13 0.23
14 0.3
15 0.36
16 0.42
17 0.49
18 0.54
19 0.62
20 0.63
21 0.64
22 0.6
23 0.62
24 0.62
25 0.57
26 0.5
27 0.42
28 0.38
29 0.35
30 0.3
31 0.25
32 0.16
33 0.13
34 0.14
35 0.14
36 0.21
37 0.23
38 0.25
39 0.24
40 0.26
41 0.26
42 0.24
43 0.23
44 0.16
45 0.16
46 0.22
47 0.23
48 0.21
49 0.21
50 0.23
51 0.23
52 0.24
53 0.22
54 0.18
55 0.17
56 0.24
57 0.28
58 0.27
59 0.25
60 0.26
61 0.31
62 0.28
63 0.28
64 0.23
65 0.19
66 0.2
67 0.19
68 0.17
69 0.11
70 0.11
71 0.1
72 0.1
73 0.13
74 0.12
75 0.12
76 0.14
77 0.16
78 0.16
79 0.16
80 0.16
81 0.22
82 0.24
83 0.26
84 0.24
85 0.23
86 0.23
87 0.23
88 0.21
89 0.12
90 0.08
91 0.08
92 0.09
93 0.09
94 0.09
95 0.08
96 0.09
97 0.13
98 0.14
99 0.15
100 0.15
101 0.15
102 0.15
103 0.16
104 0.16
105 0.14
106 0.13
107 0.12
108 0.19
109 0.2
110 0.22
111 0.26
112 0.3
113 0.33
114 0.36
115 0.44
116 0.45
117 0.51
118 0.53
119 0.57
120 0.56
121 0.51
122 0.47
123 0.37
124 0.28
125 0.2
126 0.19
127 0.12
128 0.11
129 0.15
130 0.16
131 0.16
132 0.19
133 0.23
134 0.21
135 0.21
136 0.2
137 0.18
138 0.24
139 0.34
140 0.39
141 0.41
142 0.46
143 0.5
144 0.52
145 0.58
146 0.58
147 0.56
148 0.58
149 0.61
150 0.65
151 0.71
152 0.78
153 0.8
154 0.84
155 0.86
156 0.88