Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G4PLU2

Protein Details
Accession A0A0G4PLU2    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
43-62RPPVTLRRVGPQRRKNWILYHydrophilic
119-142AMSRHQRSNSCRKGKRRGSHQALIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR012337  RNaseH-like_sf  
Amino Acid Sequences MASSSSFSSQPMDRSFNPLLSIEPSSDAFLDSDFQSSDVITRRPPVTLRRVGPQRRKNWILYEPEQEREFLEWWEKTEYGRKLNSNGQCQIKWSTDSRHAEVWKHFDQVAILILGAQGAMSRHQRSNSCRKGKRRGSHQALISDLMQNNSMRKSPSGNRLTTLQLEEQLLKTITCLRLPFRTVENPAFQGLLNLVYSGPGVLELPSAKTLRRRLRDAVTTHQELQLQDLPENAKVSLALDCWTSPFQQAFMAITVYFIDKDWNYREMLLGFEPLHGPHTGVNLSEVLHQLLKERRLLDRIFSVTTDNATNNETLIRALQEKLISAGAIGSRESIVRVPCMAHVIQLCLKQLLGHIRAAPKNKEVRTFWSDTQAGSLRDSADHGEVAHTLAKVTADNQNRNRKFAVLDLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.41
3 0.39
4 0.38
5 0.33
6 0.29
7 0.27
8 0.27
9 0.21
10 0.2
11 0.2
12 0.19
13 0.18
14 0.17
15 0.14
16 0.12
17 0.14
18 0.12
19 0.13
20 0.12
21 0.12
22 0.11
23 0.11
24 0.14
25 0.16
26 0.18
27 0.18
28 0.24
29 0.24
30 0.27
31 0.31
32 0.36
33 0.41
34 0.48
35 0.49
36 0.54
37 0.63
38 0.71
39 0.77
40 0.78
41 0.77
42 0.78
43 0.81
44 0.76
45 0.73
46 0.7
47 0.68
48 0.63
49 0.63
50 0.57
51 0.55
52 0.51
53 0.44
54 0.38
55 0.32
56 0.28
57 0.21
58 0.24
59 0.2
60 0.22
61 0.25
62 0.24
63 0.24
64 0.31
65 0.34
66 0.34
67 0.39
68 0.39
69 0.4
70 0.48
71 0.53
72 0.52
73 0.54
74 0.53
75 0.48
76 0.48
77 0.48
78 0.42
79 0.38
80 0.35
81 0.34
82 0.38
83 0.43
84 0.42
85 0.44
86 0.44
87 0.46
88 0.46
89 0.48
90 0.41
91 0.38
92 0.35
93 0.29
94 0.27
95 0.23
96 0.19
97 0.12
98 0.1
99 0.07
100 0.07
101 0.06
102 0.05
103 0.04
104 0.03
105 0.04
106 0.07
107 0.11
108 0.15
109 0.17
110 0.21
111 0.27
112 0.34
113 0.45
114 0.52
115 0.59
116 0.64
117 0.7
118 0.78
119 0.82
120 0.84
121 0.83
122 0.84
123 0.81
124 0.8
125 0.75
126 0.67
127 0.58
128 0.51
129 0.41
130 0.34
131 0.26
132 0.2
133 0.18
134 0.16
135 0.16
136 0.16
137 0.17
138 0.14
139 0.14
140 0.19
141 0.23
142 0.33
143 0.37
144 0.37
145 0.37
146 0.38
147 0.39
148 0.35
149 0.32
150 0.22
151 0.18
152 0.18
153 0.17
154 0.15
155 0.15
156 0.13
157 0.1
158 0.1
159 0.13
160 0.13
161 0.14
162 0.15
163 0.15
164 0.18
165 0.2
166 0.21
167 0.2
168 0.24
169 0.26
170 0.28
171 0.27
172 0.25
173 0.24
174 0.23
175 0.19
176 0.15
177 0.11
178 0.09
179 0.07
180 0.06
181 0.05
182 0.05
183 0.05
184 0.04
185 0.04
186 0.03
187 0.03
188 0.03
189 0.04
190 0.04
191 0.05
192 0.07
193 0.08
194 0.09
195 0.14
196 0.22
197 0.3
198 0.34
199 0.38
200 0.4
201 0.45
202 0.51
203 0.49
204 0.49
205 0.46
206 0.44
207 0.41
208 0.39
209 0.36
210 0.29
211 0.29
212 0.25
213 0.2
214 0.17
215 0.17
216 0.16
217 0.15
218 0.16
219 0.13
220 0.09
221 0.08
222 0.09
223 0.08
224 0.07
225 0.07
226 0.07
227 0.07
228 0.08
229 0.1
230 0.09
231 0.1
232 0.1
233 0.1
234 0.1
235 0.11
236 0.1
237 0.09
238 0.09
239 0.08
240 0.08
241 0.08
242 0.07
243 0.07
244 0.06
245 0.08
246 0.07
247 0.11
248 0.14
249 0.15
250 0.15
251 0.15
252 0.16
253 0.14
254 0.16
255 0.13
256 0.12
257 0.11
258 0.11
259 0.11
260 0.1
261 0.12
262 0.1
263 0.1
264 0.09
265 0.11
266 0.11
267 0.1
268 0.11
269 0.1
270 0.1
271 0.12
272 0.11
273 0.1
274 0.11
275 0.11
276 0.15
277 0.19
278 0.21
279 0.23
280 0.24
281 0.26
282 0.3
283 0.31
284 0.29
285 0.29
286 0.29
287 0.26
288 0.25
289 0.25
290 0.2
291 0.21
292 0.2
293 0.15
294 0.14
295 0.14
296 0.14
297 0.12
298 0.12
299 0.1
300 0.09
301 0.09
302 0.1
303 0.1
304 0.11
305 0.13
306 0.13
307 0.13
308 0.14
309 0.14
310 0.12
311 0.1
312 0.1
313 0.09
314 0.09
315 0.09
316 0.08
317 0.08
318 0.09
319 0.1
320 0.12
321 0.12
322 0.13
323 0.14
324 0.14
325 0.14
326 0.18
327 0.17
328 0.18
329 0.17
330 0.2
331 0.23
332 0.25
333 0.25
334 0.22
335 0.21
336 0.18
337 0.21
338 0.25
339 0.24
340 0.24
341 0.26
342 0.33
343 0.39
344 0.45
345 0.45
346 0.45
347 0.52
348 0.53
349 0.57
350 0.53
351 0.56
352 0.57
353 0.59
354 0.53
355 0.52
356 0.49
357 0.42
358 0.44
359 0.41
360 0.35
361 0.3
362 0.3
363 0.22
364 0.22
365 0.23
366 0.2
367 0.17
368 0.16
369 0.15
370 0.14
371 0.14
372 0.15
373 0.16
374 0.13
375 0.12
376 0.12
377 0.13
378 0.12
379 0.15
380 0.21
381 0.27
382 0.37
383 0.46
384 0.56
385 0.58
386 0.62
387 0.61
388 0.56
389 0.49