Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G4NYI0

Protein Details
Accession A0A0G4NYI0    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MVCEGKRKKSSSKPQGPKKREPLATTHydrophilic
NLS Segment(s)
PositionSequence
6-20KRKKSSSKPQGPKKR
Subcellular Location(s) nucl 14.5, cyto_nucl 11, mito 7, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MVCEGKRKKSSSKPQGPKKREPLATTFSCLFCNHENSVIVKLDKKLGLGDLSCKVCGQKFQTGINYLSAPVDVYSDWVDACDAVAKDTANQYDAPNPSQQRGISKQGIPEETGQGDSYDDDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.93
3 0.92
4 0.91
5 0.89
6 0.88
7 0.82
8 0.76
9 0.71
10 0.67
11 0.61
12 0.55
13 0.48
14 0.39
15 0.35
16 0.31
17 0.28
18 0.24
19 0.25
20 0.22
21 0.22
22 0.23
23 0.22
24 0.25
25 0.24
26 0.21
27 0.19
28 0.19
29 0.2
30 0.19
31 0.18
32 0.15
33 0.14
34 0.14
35 0.12
36 0.14
37 0.15
38 0.16
39 0.16
40 0.15
41 0.15
42 0.14
43 0.17
44 0.18
45 0.19
46 0.2
47 0.22
48 0.24
49 0.27
50 0.27
51 0.25
52 0.21
53 0.16
54 0.14
55 0.11
56 0.09
57 0.06
58 0.06
59 0.05
60 0.06
61 0.06
62 0.07
63 0.06
64 0.06
65 0.06
66 0.06
67 0.06
68 0.08
69 0.07
70 0.08
71 0.09
72 0.09
73 0.1
74 0.13
75 0.13
76 0.11
77 0.12
78 0.13
79 0.18
80 0.2
81 0.21
82 0.25
83 0.26
84 0.27
85 0.3
86 0.3
87 0.31
88 0.35
89 0.4
90 0.39
91 0.4
92 0.43
93 0.45
94 0.45
95 0.4
96 0.37
97 0.33
98 0.29
99 0.28
100 0.24
101 0.18
102 0.17