Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G4PTN1

Protein Details
Accession A0A0G4PTN1    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
72-99MTAFKTCRSKWKTFSRCKGKQRGCTEYLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 4.5, cyto_nucl 4
Family & Domain DBs
Amino Acid Sequences MVFNGTRRFLPYLDQRLRSLPQQTLIVDPVSPSIEIGKRGSSMVAQKNTIIPSWSRCIHVPLSSDSRGSTPMTAFKTCRSKWKTFSRCKGKQRGCTEYLGKDLASLNQPYE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.47
3 0.49
4 0.52
5 0.49
6 0.44
7 0.36
8 0.32
9 0.32
10 0.31
11 0.29
12 0.28
13 0.23
14 0.18
15 0.16
16 0.14
17 0.12
18 0.11
19 0.09
20 0.1
21 0.12
22 0.14
23 0.15
24 0.14
25 0.14
26 0.14
27 0.14
28 0.13
29 0.18
30 0.23
31 0.24
32 0.23
33 0.23
34 0.25
35 0.26
36 0.24
37 0.18
38 0.12
39 0.13
40 0.17
41 0.18
42 0.17
43 0.16
44 0.19
45 0.19
46 0.21
47 0.2
48 0.19
49 0.23
50 0.22
51 0.22
52 0.2
53 0.19
54 0.18
55 0.17
56 0.15
57 0.11
58 0.15
59 0.18
60 0.2
61 0.2
62 0.25
63 0.33
64 0.34
65 0.43
66 0.45
67 0.48
68 0.55
69 0.65
70 0.69
71 0.71
72 0.81
73 0.81
74 0.84
75 0.87
76 0.9
77 0.88
78 0.87
79 0.85
80 0.82
81 0.75
82 0.72
83 0.67
84 0.59
85 0.54
86 0.46
87 0.36
88 0.3
89 0.28
90 0.25
91 0.25