Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G4NTI0

Protein Details
Accession A0A0G4NTI0    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
42-72KPLLTLISQKKKKKKEKRKKESPPITPPQGCHydrophilic
NLS Segment(s)
PositionSequence
51-62KKKKKKEKRKKE
Subcellular Location(s) cyto_nucl 13.5, cyto 10, nucl 9, mito 7
Family & Domain DBs
Amino Acid Sequences MPPGAITSTLTITITTHGPIINLGSHPQHNLTGYPLDPQATKPLLTLISQKKKKKKEKRKKESPPITPPQGCTGPVLQSNPTGTNYIKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.1
4 0.1
5 0.09
6 0.1
7 0.1
8 0.1
9 0.1
10 0.11
11 0.13
12 0.14
13 0.15
14 0.16
15 0.16
16 0.15
17 0.15
18 0.15
19 0.14
20 0.13
21 0.14
22 0.13
23 0.12
24 0.12
25 0.12
26 0.15
27 0.14
28 0.14
29 0.12
30 0.13
31 0.13
32 0.13
33 0.2
34 0.24
35 0.33
36 0.4
37 0.48
38 0.55
39 0.65
40 0.75
41 0.79
42 0.82
43 0.84
44 0.88
45 0.92
46 0.95
47 0.96
48 0.96
49 0.95
50 0.93
51 0.91
52 0.88
53 0.86
54 0.77
55 0.67
56 0.62
57 0.54
58 0.45
59 0.38
60 0.32
61 0.27
62 0.28
63 0.28
64 0.24
65 0.24
66 0.27
67 0.26
68 0.26
69 0.25