Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G4NWD3

Protein Details
Accession A0A0G4NWD3    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
197-218LAWFLFRRRRKHSQDSQYIQPPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, plas 4, cyto 3, golg 3, mito 1, pero 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSTDEYLEGYSLRRNGTCADGEEDCGGTWGSFRRCCPGNTECPAEDGAPGICCPTTKNCEAALKNKQRCADTTADLYPVQSSDGFFCCTNDTLGFYTPSNDFVGCAKAQDVNDFSDEAKTVVAAVQYTLSTSSSSTTSTSSNIATATTLSSSTPGTISATPTPTNNANTDTSHSNNTGAIAGGVVGGIAGVVILIGLAWFLFRRRRKHSQDSQYIQPPPGPVSELSDSNQITELSGQSVSELPGSEHRKFPPAELAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.25
4 0.27
5 0.25
6 0.26
7 0.25
8 0.26
9 0.26
10 0.24
11 0.19
12 0.17
13 0.15
14 0.1
15 0.11
16 0.15
17 0.2
18 0.23
19 0.24
20 0.3
21 0.32
22 0.34
23 0.38
24 0.39
25 0.42
26 0.44
27 0.49
28 0.43
29 0.42
30 0.42
31 0.36
32 0.29
33 0.21
34 0.16
35 0.11
36 0.11
37 0.1
38 0.09
39 0.08
40 0.11
41 0.16
42 0.21
43 0.22
44 0.25
45 0.27
46 0.35
47 0.38
48 0.44
49 0.49
50 0.53
51 0.57
52 0.58
53 0.59
54 0.53
55 0.52
56 0.49
57 0.43
58 0.35
59 0.34
60 0.3
61 0.29
62 0.27
63 0.25
64 0.19
65 0.15
66 0.13
67 0.09
68 0.09
69 0.09
70 0.1
71 0.12
72 0.12
73 0.12
74 0.13
75 0.13
76 0.14
77 0.12
78 0.13
79 0.12
80 0.13
81 0.14
82 0.12
83 0.13
84 0.13
85 0.14
86 0.13
87 0.11
88 0.11
89 0.1
90 0.12
91 0.1
92 0.1
93 0.09
94 0.11
95 0.12
96 0.13
97 0.14
98 0.12
99 0.13
100 0.13
101 0.13
102 0.11
103 0.11
104 0.09
105 0.07
106 0.06
107 0.05
108 0.05
109 0.05
110 0.04
111 0.04
112 0.05
113 0.05
114 0.05
115 0.05
116 0.05
117 0.05
118 0.05
119 0.06
120 0.06
121 0.07
122 0.08
123 0.09
124 0.09
125 0.1
126 0.11
127 0.1
128 0.1
129 0.09
130 0.08
131 0.07
132 0.07
133 0.06
134 0.06
135 0.06
136 0.05
137 0.06
138 0.06
139 0.06
140 0.06
141 0.06
142 0.08
143 0.08
144 0.11
145 0.12
146 0.14
147 0.15
148 0.15
149 0.17
150 0.18
151 0.19
152 0.18
153 0.19
154 0.18
155 0.19
156 0.22
157 0.23
158 0.22
159 0.22
160 0.22
161 0.19
162 0.18
163 0.17
164 0.15
165 0.11
166 0.09
167 0.06
168 0.05
169 0.04
170 0.04
171 0.03
172 0.02
173 0.02
174 0.02
175 0.02
176 0.01
177 0.01
178 0.01
179 0.01
180 0.01
181 0.01
182 0.01
183 0.01
184 0.02
185 0.02
186 0.03
187 0.06
188 0.15
189 0.22
190 0.3
191 0.39
192 0.5
193 0.59
194 0.69
195 0.77
196 0.8
197 0.84
198 0.82
199 0.81
200 0.79
201 0.73
202 0.63
203 0.55
204 0.45
205 0.36
206 0.31
207 0.26
208 0.18
209 0.21
210 0.23
211 0.23
212 0.23
213 0.27
214 0.26
215 0.25
216 0.26
217 0.2
218 0.18
219 0.17
220 0.16
221 0.12
222 0.12
223 0.11
224 0.1
225 0.12
226 0.11
227 0.11
228 0.11
229 0.11
230 0.2
231 0.26
232 0.28
233 0.32
234 0.34
235 0.4
236 0.4
237 0.41