Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G4PTW9

Protein Details
Accession A0A0G4PTW9    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
235-260SELRAANEKQKQKRTRSRRQMLAEESHydrophilic
293-318QPRTKPPRGCGICRKPGHRRETCPDRBasic
NLS Segment(s)
Subcellular Location(s) mito 11.5, nucl 9.5, cyto_mito 9.333, cyto_nucl 8.333, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR004875  DDE_SF_endonuclease_dom  
IPR036397  RNaseH_sf  
Gene Ontology GO:0004519  F:endonuclease activity  
GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF03184  DDE_1  
Amino Acid Sequences MGLTATAKVVTRSEYYGKVFIESWFDGLPEDWRFEVSPNGWTSGEIGLRWLEKLFIPTTSSRTKGGYRLLILDGHGSHLSPNFDQICEENKIILICMPPHSSHLLQPLDIGCFAVLKRSYGRMVEMKMRNGINYIDKFDFLEAYPLARTEAFKSETIKNSFRAAGLVPFSPERVISKLDIRLRTPTPPPSSRGSEWDPKTPSNYVQLQKQASSIKALLPCQITMQSAALLEKEVSELRAANEKQKQKRTRSRRQMLAEESLSVQEASALIMQPVEVVEAPLPGPGIPGESALQPRTKPPRGCGICRKPGHRRETCPDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.31
3 0.34
4 0.33
5 0.32
6 0.3
7 0.27
8 0.29
9 0.25
10 0.23
11 0.19
12 0.18
13 0.17
14 0.16
15 0.2
16 0.15
17 0.17
18 0.15
19 0.17
20 0.17
21 0.18
22 0.23
23 0.19
24 0.23
25 0.23
26 0.26
27 0.24
28 0.24
29 0.24
30 0.22
31 0.22
32 0.16
33 0.16
34 0.15
35 0.15
36 0.16
37 0.14
38 0.12
39 0.11
40 0.15
41 0.15
42 0.14
43 0.17
44 0.18
45 0.23
46 0.27
47 0.28
48 0.27
49 0.29
50 0.3
51 0.32
52 0.36
53 0.35
54 0.32
55 0.32
56 0.32
57 0.29
58 0.27
59 0.24
60 0.18
61 0.16
62 0.15
63 0.12
64 0.12
65 0.13
66 0.15
67 0.13
68 0.18
69 0.16
70 0.16
71 0.17
72 0.18
73 0.2
74 0.21
75 0.21
76 0.16
77 0.16
78 0.16
79 0.15
80 0.15
81 0.12
82 0.1
83 0.12
84 0.14
85 0.14
86 0.16
87 0.2
88 0.19
89 0.2
90 0.26
91 0.24
92 0.21
93 0.23
94 0.21
95 0.18
96 0.17
97 0.15
98 0.08
99 0.08
100 0.08
101 0.11
102 0.11
103 0.11
104 0.12
105 0.15
106 0.16
107 0.16
108 0.2
109 0.18
110 0.2
111 0.28
112 0.29
113 0.29
114 0.32
115 0.31
116 0.28
117 0.26
118 0.25
119 0.22
120 0.2
121 0.22
122 0.18
123 0.18
124 0.18
125 0.17
126 0.17
127 0.11
128 0.12
129 0.08
130 0.08
131 0.08
132 0.08
133 0.09
134 0.08
135 0.09
136 0.08
137 0.12
138 0.14
139 0.15
140 0.18
141 0.22
142 0.27
143 0.31
144 0.31
145 0.28
146 0.28
147 0.27
148 0.23
149 0.2
150 0.15
151 0.13
152 0.12
153 0.11
154 0.1
155 0.1
156 0.1
157 0.09
158 0.09
159 0.09
160 0.09
161 0.1
162 0.11
163 0.14
164 0.19
165 0.24
166 0.26
167 0.26
168 0.29
169 0.29
170 0.31
171 0.32
172 0.33
173 0.35
174 0.36
175 0.38
176 0.38
177 0.42
178 0.39
179 0.41
180 0.39
181 0.41
182 0.41
183 0.45
184 0.43
185 0.39
186 0.4
187 0.37
188 0.33
189 0.31
190 0.35
191 0.31
192 0.32
193 0.37
194 0.35
195 0.34
196 0.36
197 0.32
198 0.26
199 0.26
200 0.22
201 0.2
202 0.21
203 0.22
204 0.22
205 0.21
206 0.2
207 0.19
208 0.19
209 0.16
210 0.14
211 0.14
212 0.11
213 0.1
214 0.1
215 0.09
216 0.08
217 0.08
218 0.07
219 0.08
220 0.07
221 0.08
222 0.08
223 0.09
224 0.1
225 0.18
226 0.19
227 0.25
228 0.33
229 0.41
230 0.49
231 0.59
232 0.66
233 0.69
234 0.79
235 0.82
236 0.85
237 0.88
238 0.89
239 0.88
240 0.87
241 0.84
242 0.79
243 0.75
244 0.64
245 0.54
246 0.45
247 0.36
248 0.29
249 0.21
250 0.15
251 0.09
252 0.08
253 0.07
254 0.08
255 0.07
256 0.07
257 0.07
258 0.07
259 0.06
260 0.06
261 0.07
262 0.05
263 0.06
264 0.06
265 0.07
266 0.08
267 0.08
268 0.08
269 0.07
270 0.08
271 0.07
272 0.09
273 0.08
274 0.1
275 0.11
276 0.13
277 0.17
278 0.19
279 0.23
280 0.22
281 0.3
282 0.39
283 0.47
284 0.48
285 0.49
286 0.58
287 0.62
288 0.7
289 0.72
290 0.73
291 0.74
292 0.77
293 0.82
294 0.81
295 0.83
296 0.84
297 0.82
298 0.81