Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G4PPH7

Protein Details
Accession A0A0G4PPH7    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
71-95FKWMHDRDRRKEKEKREKEKAQFGKBasic
142-167NDMARKRQKNYIKRVKKDQRAEDLSRHydrophilic
NLS Segment(s)
PositionSequence
77-96RDRRKEKEKREKEKAQFGKV
Subcellular Location(s) nucl 9.5, cyto_nucl 9, cyto 7.5, cysk 6, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011431  Trafficking_Pga2  
Pfam View protein in Pfam  
PF07543  PGA2  
Amino Acid Sequences MSTPQSDLSEKAAEAANDFFAQLYAFFELVITRFFKNGYASIAQMSGKRWTKVIGSVIFYLILRPYIEKTFKWMHDRDRRKEKEKREKEKAQFGKVKVSPNSLRAGGDSGKGKVLGEVDNTDDELEDEEDLMAAASGVPEWNDMARKRQKNYIKRVKKDQRAEDLSRDQIMELLDWSEEEEVDVKVKKDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.16
4 0.13
5 0.14
6 0.12
7 0.1
8 0.1
9 0.08
10 0.09
11 0.08
12 0.08
13 0.08
14 0.08
15 0.08
16 0.09
17 0.11
18 0.11
19 0.1
20 0.11
21 0.11
22 0.13
23 0.15
24 0.16
25 0.18
26 0.17
27 0.17
28 0.18
29 0.19
30 0.18
31 0.17
32 0.18
33 0.22
34 0.25
35 0.25
36 0.24
37 0.24
38 0.25
39 0.28
40 0.32
41 0.26
42 0.25
43 0.25
44 0.25
45 0.24
46 0.22
47 0.18
48 0.12
49 0.1
50 0.07
51 0.08
52 0.1
53 0.14
54 0.17
55 0.16
56 0.21
57 0.26
58 0.3
59 0.35
60 0.37
61 0.42
62 0.5
63 0.59
64 0.62
65 0.68
66 0.71
67 0.73
68 0.77
69 0.79
70 0.8
71 0.81
72 0.82
73 0.81
74 0.84
75 0.81
76 0.83
77 0.77
78 0.74
79 0.69
80 0.6
81 0.59
82 0.52
83 0.52
84 0.43
85 0.44
86 0.37
87 0.33
88 0.35
89 0.27
90 0.24
91 0.19
92 0.2
93 0.15
94 0.15
95 0.14
96 0.13
97 0.13
98 0.13
99 0.12
100 0.11
101 0.11
102 0.09
103 0.09
104 0.1
105 0.1
106 0.11
107 0.11
108 0.1
109 0.08
110 0.08
111 0.08
112 0.07
113 0.06
114 0.06
115 0.05
116 0.05
117 0.05
118 0.05
119 0.03
120 0.03
121 0.03
122 0.02
123 0.03
124 0.03
125 0.03
126 0.04
127 0.04
128 0.06
129 0.11
130 0.12
131 0.22
132 0.31
133 0.38
134 0.41
135 0.5
136 0.59
137 0.64
138 0.74
139 0.76
140 0.77
141 0.79
142 0.87
143 0.88
144 0.88
145 0.88
146 0.86
147 0.85
148 0.82
149 0.79
150 0.76
151 0.71
152 0.64
153 0.55
154 0.47
155 0.36
156 0.3
157 0.26
158 0.19
159 0.13
160 0.11
161 0.09
162 0.09
163 0.1
164 0.09
165 0.08
166 0.08
167 0.09
168 0.08
169 0.12
170 0.15