Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G4NT25

Protein Details
Accession A0A0G4NT25    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
71-90RGSCKAWRTKNHSARRLNCSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, extr 5, pero 4, cyto 3
Family & Domain DBs
Amino Acid Sequences MLAQLGRDMKRVQHGFAPCFDRLVALLPDLEYASTAVTHCTIDAVTALEERNAKKLSNLGDTKNIKLPNVRGSCKAWRTKNHSARRLNCSAPIPLLPRLRIMDEQILTWVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.39
3 0.43
4 0.44
5 0.34
6 0.34
7 0.31
8 0.25
9 0.19
10 0.21
11 0.16
12 0.11
13 0.12
14 0.1
15 0.11
16 0.11
17 0.1
18 0.06
19 0.06
20 0.05
21 0.05
22 0.05
23 0.06
24 0.06
25 0.06
26 0.06
27 0.06
28 0.06
29 0.05
30 0.06
31 0.05
32 0.05
33 0.06
34 0.06
35 0.07
36 0.09
37 0.1
38 0.14
39 0.14
40 0.14
41 0.13
42 0.16
43 0.17
44 0.23
45 0.25
46 0.22
47 0.3
48 0.31
49 0.33
50 0.35
51 0.33
52 0.26
53 0.27
54 0.28
55 0.29
56 0.33
57 0.33
58 0.32
59 0.36
60 0.43
61 0.47
62 0.53
63 0.5
64 0.53
65 0.6
66 0.68
67 0.74
68 0.76
69 0.78
70 0.8
71 0.8
72 0.8
73 0.76
74 0.67
75 0.62
76 0.54
77 0.47
78 0.4
79 0.36
80 0.32
81 0.34
82 0.36
83 0.32
84 0.33
85 0.34
86 0.35
87 0.34
88 0.34
89 0.35
90 0.31
91 0.3