Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G4PB16

Protein Details
Accession A0A0G4PB16    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
32-51NSSVQKRQKNKEEKEKREAAHydrophilic
NLS Segment(s)
PositionSequence
38-54RQKNKEEKEKREAAARA
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 5
Family & Domain DBs
Amino Acid Sequences MSGIDPNARREVNNALTSSGSAAVGQMVDTANSSVQKRQKNKEEKEKREAAARAAKQEADAAKGGASS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.28
3 0.28
4 0.27
5 0.25
6 0.18
7 0.12
8 0.08
9 0.07
10 0.06
11 0.05
12 0.05
13 0.05
14 0.04
15 0.04
16 0.04
17 0.05
18 0.05
19 0.07
20 0.08
21 0.12
22 0.18
23 0.25
24 0.32
25 0.39
26 0.49
27 0.57
28 0.65
29 0.72
30 0.77
31 0.78
32 0.8
33 0.79
34 0.7
35 0.67
36 0.61
37 0.56
38 0.54
39 0.49
40 0.45
41 0.41
42 0.4
43 0.32
44 0.35
45 0.29
46 0.23
47 0.22
48 0.17