Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G4PVH2

Protein Details
Accession A0A0G4PVH2    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
82-101DDAPKPKNKARKETDRGRGGBasic
NLS Segment(s)
PositionSequence
85-125PKPKNKARKETDRGRGGGRGGPRGRGGRGGPPRGRARGRGF
Subcellular Location(s) mito 10cyto_nucl 10, nucl 9.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027141  LSm4/Sm_D1/D3  
IPR010920  LSM_dom_sf  
IPR047575  Sm  
IPR034102  Sm_D1  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:0005634  C:nucleus  
GO:1990904  C:ribonucleoprotein complex  
GO:0120114  C:Sm-like protein family complex  
GO:0003723  F:RNA binding  
GO:0000387  P:spliceosomal snRNP assembly  
GO:0008033  P:tRNA processing  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
CDD cd01724  Sm_D1  
Amino Acid Sequences MKLVRFLMKCANETVTVELKNGTILHGTIVAVSPQMNTSLRAVKMTPKGRDTVSLDTINIRGSTIRYYILPDSLPLDTLLVDDAPKPKNKARKETDRGRGGGRGGPRGRGGRGGPPRGRARGRGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.28
3 0.25
4 0.24
5 0.21
6 0.19
7 0.19
8 0.17
9 0.14
10 0.1
11 0.09
12 0.09
13 0.1
14 0.09
15 0.08
16 0.08
17 0.07
18 0.07
19 0.07
20 0.06
21 0.06
22 0.08
23 0.09
24 0.1
25 0.12
26 0.16
27 0.16
28 0.17
29 0.18
30 0.21
31 0.29
32 0.35
33 0.36
34 0.33
35 0.35
36 0.34
37 0.38
38 0.36
39 0.32
40 0.29
41 0.26
42 0.25
43 0.24
44 0.23
45 0.19
46 0.15
47 0.11
48 0.07
49 0.07
50 0.08
51 0.08
52 0.08
53 0.08
54 0.1
55 0.1
56 0.11
57 0.1
58 0.09
59 0.11
60 0.1
61 0.1
62 0.08
63 0.08
64 0.07
65 0.07
66 0.07
67 0.05
68 0.05
69 0.06
70 0.1
71 0.13
72 0.16
73 0.2
74 0.25
75 0.34
76 0.41
77 0.5
78 0.55
79 0.63
80 0.69
81 0.76
82 0.8
83 0.78
84 0.73
85 0.66
86 0.6
87 0.51
88 0.46
89 0.4
90 0.39
91 0.34
92 0.35
93 0.37
94 0.37
95 0.37
96 0.38
97 0.37
98 0.37
99 0.45
100 0.52
101 0.51
102 0.56
103 0.61
104 0.64
105 0.67