Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G4PS45

Protein Details
Accession A0A0G4PS45   
Localization Confidence Low
Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
13-39KDVISKSKLIRQKQCRRKTSLMKKACEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
Amino Acid Sequences MRSMAAIKATRSKDVISKSKLIRQKQCRRKTSLMKKACEYSRMCSADVCVGIRMRETGQVHILSADASGFWAFLTSQLSSHYPTPTVMTDRDLEKTKEETVFREQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.46
3 0.42
4 0.48
5 0.49
6 0.55
7 0.6
8 0.63
9 0.65
10 0.67
11 0.73
12 0.76
13 0.82
14 0.82
15 0.83
16 0.84
17 0.85
18 0.85
19 0.85
20 0.82
21 0.76
22 0.72
23 0.7
24 0.62
25 0.57
26 0.48
27 0.42
28 0.42
29 0.4
30 0.37
31 0.3
32 0.29
33 0.25
34 0.23
35 0.19
36 0.12
37 0.1
38 0.1
39 0.1
40 0.1
41 0.08
42 0.13
43 0.13
44 0.13
45 0.15
46 0.15
47 0.15
48 0.14
49 0.14
50 0.09
51 0.08
52 0.06
53 0.03
54 0.04
55 0.04
56 0.03
57 0.03
58 0.04
59 0.04
60 0.05
61 0.07
62 0.07
63 0.08
64 0.1
65 0.12
66 0.14
67 0.16
68 0.17
69 0.15
70 0.16
71 0.18
72 0.18
73 0.2
74 0.19
75 0.2
76 0.21
77 0.22
78 0.26
79 0.28
80 0.27
81 0.28
82 0.3
83 0.31
84 0.34
85 0.34
86 0.34