Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G4PM69

Protein Details
Accession A0A0G4PM69    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
158-181LEERRKVKSKAYYERKKAARRVLAHydrophilic
NLS Segment(s)
PositionSequence
161-178RRKVKSKAYYERKKAARR
Subcellular Location(s) cyto 9.5cyto_nucl 9.5, mito 9, nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005822  Ribosomal_L13  
IPR005755  Ribosomal_L13_euk/arc  
IPR036899  Ribosomal_L13_sf  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00572  Ribosomal_L13  
CDD cd00392  Ribosomal_L13  
Amino Acid Sequences MSSFESVVVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKMTRFNPTRGGPFHFRAPSRILYKAIRGMMPHKTARGAAALERLKVFEGVPPPYDKKKRVVVPQALRVLRLRPGRKYCTVGRLSHEVGWKYQDVVSRLEERRKVKSKAYYERKKAARRVLAKAEQGANVDSKTKTQLAQYGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.1
5 0.11
6 0.11
7 0.11
8 0.11
9 0.11
10 0.15
11 0.16
12 0.15
13 0.14
14 0.21
15 0.28
16 0.3
17 0.29
18 0.26
19 0.26
20 0.28
21 0.29
22 0.23
23 0.17
24 0.16
25 0.16
26 0.17
27 0.14
28 0.13
29 0.14
30 0.12
31 0.12
32 0.12
33 0.12
34 0.11
35 0.11
36 0.14
37 0.13
38 0.14
39 0.18
40 0.22
41 0.29
42 0.37
43 0.45
44 0.45
45 0.52
46 0.56
47 0.6
48 0.59
49 0.54
50 0.56
51 0.54
52 0.53
53 0.53
54 0.49
55 0.46
56 0.45
57 0.48
58 0.43
59 0.4
60 0.43
61 0.39
62 0.37
63 0.35
64 0.35
65 0.35
66 0.33
67 0.32
68 0.29
69 0.26
70 0.28
71 0.29
72 0.27
73 0.23
74 0.21
75 0.21
76 0.23
77 0.26
78 0.25
79 0.21
80 0.21
81 0.2
82 0.2
83 0.18
84 0.13
85 0.09
86 0.16
87 0.16
88 0.15
89 0.15
90 0.15
91 0.14
92 0.14
93 0.13
94 0.09
95 0.11
96 0.12
97 0.13
98 0.16
99 0.19
100 0.26
101 0.32
102 0.32
103 0.34
104 0.4
105 0.45
106 0.5
107 0.56
108 0.58
109 0.58
110 0.63
111 0.66
112 0.58
113 0.54
114 0.46
115 0.39
116 0.36
117 0.38
118 0.34
119 0.35
120 0.42
121 0.47
122 0.5
123 0.53
124 0.5
125 0.52
126 0.53
127 0.47
128 0.44
129 0.44
130 0.42
131 0.41
132 0.42
133 0.34
134 0.3
135 0.3
136 0.26
137 0.22
138 0.22
139 0.22
140 0.2
141 0.21
142 0.24
143 0.29
144 0.32
145 0.38
146 0.43
147 0.43
148 0.51
149 0.56
150 0.57
151 0.57
152 0.62
153 0.65
154 0.7
155 0.77
156 0.78
157 0.78
158 0.83
159 0.84
160 0.84
161 0.82
162 0.81
163 0.79
164 0.75
165 0.75
166 0.75
167 0.73
168 0.68
169 0.65
170 0.58
171 0.5
172 0.45
173 0.39
174 0.31
175 0.25
176 0.25
177 0.21
178 0.2
179 0.22
180 0.23
181 0.23
182 0.25