Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G4NTG1

Protein Details
Accession A0A0G4NTG1    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
369-391EEEPKPAPVRRSKRSAKGGKAQEBasic
NLS Segment(s)
PositionSequence
374-389PAPVRRSKRSAKGGKA
Subcellular Location(s) nucl 10.5, cyto_nucl 8.5, cyto 5.5, plas 4, mito 3, extr 1, pero 1, cysk 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR040115  Lnp  
IPR019273  Lunapark_dom  
Gene Ontology GO:0098826  C:endoplasmic reticulum tubular network membrane  
GO:0046872  F:metal ion binding  
GO:0071788  P:endoplasmic reticulum tubular network maintenance  
GO:1903373  P:positive regulation of endoplasmic reticulum tubular network organization  
Pfam View protein in Pfam  
PF10058  zinc_ribbon_10  
Amino Acid Sequences MVYFWPWKGNDDSAASFEKTLSTLSTKIAQATTRLDQQRQSSRRIKALWTLYSTFAYLLYSIILALVLGWESWGIKEYAAIAGGPVLIYGVRTLSSRIFDYRISRIQRRLDDFHKQREETIEKLKVATKYNSTQQLLEKYGGESPKPSPGPKGQTDKGKPAQQPQNVPRTGLPPPPTANIRRPPSASHEPPSPDYSSPPLELTQGAPQTPQQPSFPPPFTPQPPTDQPSFAPNAFPQNGESIEQPHWYDRLLDVLLGEDETQPRNRMVMICSACRLVNGQAPPGIKTLEELGRWRCCSCGAWNGVESETTKMLNNLRQDAVPAEGTWEPVSKAEADTQSSESTEEGVMVASSEEEQVNSIGSDAEDQTEEEPKPAPVRRSKRSAKGGKAQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.31
3 0.27
4 0.25
5 0.21
6 0.18
7 0.17
8 0.16
9 0.15
10 0.16
11 0.18
12 0.23
13 0.23
14 0.25
15 0.26
16 0.25
17 0.25
18 0.3
19 0.31
20 0.35
21 0.39
22 0.4
23 0.42
24 0.49
25 0.56
26 0.55
27 0.6
28 0.59
29 0.6
30 0.65
31 0.63
32 0.58
33 0.56
34 0.6
35 0.56
36 0.53
37 0.49
38 0.44
39 0.42
40 0.38
41 0.3
42 0.22
43 0.17
44 0.12
45 0.1
46 0.08
47 0.06
48 0.06
49 0.05
50 0.05
51 0.04
52 0.04
53 0.04
54 0.03
55 0.03
56 0.03
57 0.04
58 0.04
59 0.05
60 0.06
61 0.06
62 0.06
63 0.07
64 0.08
65 0.08
66 0.08
67 0.08
68 0.07
69 0.07
70 0.07
71 0.06
72 0.05
73 0.04
74 0.03
75 0.04
76 0.04
77 0.04
78 0.05
79 0.06
80 0.08
81 0.1
82 0.12
83 0.14
84 0.16
85 0.17
86 0.19
87 0.23
88 0.27
89 0.33
90 0.37
91 0.41
92 0.46
93 0.51
94 0.55
95 0.57
96 0.57
97 0.55
98 0.59
99 0.6
100 0.63
101 0.63
102 0.57
103 0.52
104 0.54
105 0.52
106 0.45
107 0.46
108 0.41
109 0.34
110 0.36
111 0.38
112 0.34
113 0.35
114 0.34
115 0.31
116 0.31
117 0.36
118 0.42
119 0.39
120 0.38
121 0.37
122 0.38
123 0.36
124 0.33
125 0.27
126 0.21
127 0.23
128 0.22
129 0.19
130 0.16
131 0.16
132 0.22
133 0.23
134 0.23
135 0.24
136 0.29
137 0.35
138 0.39
139 0.46
140 0.43
141 0.5
142 0.53
143 0.57
144 0.57
145 0.57
146 0.53
147 0.55
148 0.59
149 0.54
150 0.59
151 0.56
152 0.59
153 0.53
154 0.51
155 0.43
156 0.39
157 0.37
158 0.33
159 0.31
160 0.25
161 0.26
162 0.27
163 0.3
164 0.3
165 0.34
166 0.37
167 0.38
168 0.38
169 0.37
170 0.37
171 0.41
172 0.45
173 0.42
174 0.37
175 0.37
176 0.37
177 0.38
178 0.39
179 0.33
180 0.25
181 0.23
182 0.22
183 0.2
184 0.18
185 0.17
186 0.14
187 0.13
188 0.13
189 0.13
190 0.14
191 0.13
192 0.12
193 0.12
194 0.13
195 0.17
196 0.18
197 0.18
198 0.15
199 0.17
200 0.2
201 0.25
202 0.25
203 0.23
204 0.25
205 0.29
206 0.32
207 0.34
208 0.33
209 0.34
210 0.37
211 0.38
212 0.36
213 0.31
214 0.28
215 0.28
216 0.29
217 0.23
218 0.2
219 0.17
220 0.22
221 0.21
222 0.21
223 0.18
224 0.17
225 0.17
226 0.17
227 0.16
228 0.14
229 0.14
230 0.15
231 0.15
232 0.15
233 0.14
234 0.13
235 0.14
236 0.1
237 0.12
238 0.11
239 0.1
240 0.09
241 0.09
242 0.09
243 0.08
244 0.09
245 0.06
246 0.08
247 0.1
248 0.12
249 0.12
250 0.13
251 0.13
252 0.13
253 0.14
254 0.14
255 0.21
256 0.22
257 0.22
258 0.23
259 0.24
260 0.23
261 0.21
262 0.21
263 0.15
264 0.17
265 0.17
266 0.18
267 0.2
268 0.2
269 0.22
270 0.21
271 0.19
272 0.14
273 0.13
274 0.16
275 0.16
276 0.17
277 0.2
278 0.25
279 0.3
280 0.32
281 0.31
282 0.28
283 0.26
284 0.27
285 0.27
286 0.3
287 0.27
288 0.28
289 0.29
290 0.3
291 0.28
292 0.27
293 0.23
294 0.18
295 0.16
296 0.14
297 0.14
298 0.15
299 0.19
300 0.22
301 0.25
302 0.27
303 0.27
304 0.26
305 0.27
306 0.25
307 0.24
308 0.2
309 0.16
310 0.15
311 0.14
312 0.16
313 0.16
314 0.15
315 0.13
316 0.13
317 0.15
318 0.12
319 0.13
320 0.17
321 0.19
322 0.21
323 0.23
324 0.24
325 0.24
326 0.23
327 0.23
328 0.17
329 0.16
330 0.13
331 0.11
332 0.08
333 0.07
334 0.07
335 0.06
336 0.06
337 0.05
338 0.06
339 0.07
340 0.07
341 0.07
342 0.08
343 0.08
344 0.09
345 0.08
346 0.08
347 0.07
348 0.07
349 0.09
350 0.09
351 0.1
352 0.1
353 0.11
354 0.13
355 0.18
356 0.18
357 0.17
358 0.18
359 0.19
360 0.26
361 0.31
362 0.38
363 0.43
364 0.53
365 0.6
366 0.69
367 0.76
368 0.79
369 0.84
370 0.85
371 0.84