Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0G4PJQ4

Protein Details
Accession A0A0G4PJQ4    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
13-39RSKDTTSKRKLIRQKQCRRKASLMKKAHydrophilic
NLS Segment(s)
PositionSequence
20-23KRKL
Subcellular Location(s) nucl 16, mito 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
Amino Acid Sequences MATRSMAAIKAPRSKDTTSKRKLIRQKQCRRKASLMKKACEDSRICSADICVGIRIRETGQVHT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.48
3 0.53
4 0.58
5 0.57
6 0.62
7 0.65
8 0.69
9 0.76
10 0.77
11 0.77
12 0.78
13 0.82
14 0.85
15 0.89
16 0.87
17 0.83
18 0.81
19 0.81
20 0.8
21 0.8
22 0.76
23 0.68
24 0.65
25 0.62
26 0.55
27 0.49
28 0.4
29 0.33
30 0.34
31 0.33
32 0.3
33 0.26
34 0.26
35 0.24
36 0.24
37 0.21
38 0.16
39 0.15
40 0.15
41 0.16
42 0.17
43 0.15
44 0.21