Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0G4P2W0

Protein Details
Accession A0A0G4P2W0    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MGNGKGKNKGKGRGKKRSRGPKETKIATKVBasic
NLS Segment(s)
PositionSequence
5-25KGKNKGKGRGKKRSRGPKETK
Subcellular Location(s) nucl 10mito 10mito_nucl 10
Family & Domain DBs
Amino Acid Sequences MGNGKGKNKGKGRGKKRSRGPKETKIATKVATTVKNKGTFLGDHHCHGRHAPTWRCLRLGHVVQCPTHRKSFPRRLEDCVQCISAERRLVQQERKEKMK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.85
3 0.88
4 0.9
5 0.89
6 0.9
7 0.89
8 0.88
9 0.87
10 0.85
11 0.81
12 0.74
13 0.67
14 0.57
15 0.48
16 0.42
17 0.38
18 0.37
19 0.33
20 0.35
21 0.38
22 0.39
23 0.39
24 0.36
25 0.32
26 0.26
27 0.26
28 0.29
29 0.25
30 0.23
31 0.25
32 0.25
33 0.23
34 0.23
35 0.22
36 0.18
37 0.25
38 0.27
39 0.32
40 0.37
41 0.38
42 0.39
43 0.37
44 0.36
45 0.35
46 0.36
47 0.35
48 0.34
49 0.35
50 0.34
51 0.4
52 0.42
53 0.39
54 0.39
55 0.37
56 0.38
57 0.47
58 0.56
59 0.6
60 0.64
61 0.64
62 0.65
63 0.71
64 0.71
65 0.64
66 0.56
67 0.47
68 0.37
69 0.38
70 0.34
71 0.3
72 0.28
73 0.25
74 0.28
75 0.35
76 0.42
77 0.47
78 0.53
79 0.57