Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0G4P8F7

Protein Details
Accession A0A0G4P8F7    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
8-39VSTQSRSDKKSLRQKRDRRRLNLEKKLHQYSKHydrophilic
NLS Segment(s)
PositionSequence
16-28KKSLRQKRDRRRL
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
Amino Acid Sequences MDQNPNKVSTQSRSDKKSLRQKRDRRRLNLEKKLHQYSKLCGADVCLGIRIRDTGRVFTFSADRSGFWAFLSSKLSSYYPKPIQKSGEDLENAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.63
3 0.68
4 0.73
5 0.74
6 0.76
7 0.79
8 0.84
9 0.88
10 0.92
11 0.92
12 0.9
13 0.9
14 0.9
15 0.9
16 0.89
17 0.86
18 0.83
19 0.81
20 0.8
21 0.72
22 0.66
23 0.58
24 0.5
25 0.52
26 0.45
27 0.37
28 0.28
29 0.28
30 0.25
31 0.23
32 0.2
33 0.12
34 0.11
35 0.11
36 0.11
37 0.11
38 0.09
39 0.14
40 0.15
41 0.16
42 0.17
43 0.2
44 0.2
45 0.2
46 0.22
47 0.16
48 0.2
49 0.17
50 0.16
51 0.15
52 0.16
53 0.15
54 0.13
55 0.16
56 0.13
57 0.15
58 0.18
59 0.16
60 0.16
61 0.18
62 0.2
63 0.2
64 0.23
65 0.3
66 0.35
67 0.42
68 0.45
69 0.49
70 0.52
71 0.52
72 0.56
73 0.49
74 0.48