Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0G4PDP9

Protein Details
Accession A0A0G4PDP9    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
10-34VSATATKPKKEKGKNRCRMKTLRTNHydrophilic
NLS Segment(s)
PositionSequence
17-23PKKEKGK
Subcellular Location(s) mito 23, nucl 3
Family & Domain DBs
Amino Acid Sequences MGVLLQIAPVSATATKPKKEKGKNRCRMKTLRTNHLPFRVVIDRSGRTTATGYPTRSDAWPSAQVTAMYPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.28
3 0.32
4 0.39
5 0.48
6 0.57
7 0.66
8 0.69
9 0.75
10 0.8
11 0.87
12 0.87
13 0.85
14 0.82
15 0.8
16 0.79
17 0.74
18 0.74
19 0.71
20 0.68
21 0.65
22 0.62
23 0.54
24 0.44
25 0.43
26 0.37
27 0.29
28 0.27
29 0.27
30 0.24
31 0.25
32 0.27
33 0.22
34 0.18
35 0.19
36 0.19
37 0.22
38 0.25
39 0.24
40 0.24
41 0.26
42 0.27
43 0.27
44 0.28
45 0.23
46 0.24
47 0.28
48 0.28
49 0.28
50 0.28
51 0.27