Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0G4PVE5

Protein Details
Accession A0A0G4PVE5    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
12-34ADAVNQKARRRRRTLFKKASEYSHydrophilic
NLS Segment(s)
PositionSequence
20-24RRRRR
Subcellular Location(s) nucl 22, cyto_nucl 12.833, mito_nucl 12.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
Amino Acid Sequences MVVPQKSETNLADAVNQKARRRRRTLFKKASEYSSECGADIHIVLRMKKSGKIFILTSNSEGWPLSQNQLMSYHPTPIHTSPESP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.31
3 0.35
4 0.37
5 0.44
6 0.53
7 0.58
8 0.64
9 0.68
10 0.71
11 0.78
12 0.84
13 0.86
14 0.85
15 0.84
16 0.78
17 0.74
18 0.68
19 0.59
20 0.5
21 0.43
22 0.34
23 0.25
24 0.22
25 0.18
26 0.13
27 0.1
28 0.08
29 0.07
30 0.08
31 0.08
32 0.09
33 0.12
34 0.13
35 0.16
36 0.18
37 0.2
38 0.21
39 0.24
40 0.24
41 0.27
42 0.31
43 0.28
44 0.28
45 0.25
46 0.23
47 0.21
48 0.2
49 0.15
50 0.14
51 0.14
52 0.15
53 0.15
54 0.15
55 0.16
56 0.18
57 0.19
58 0.22
59 0.22
60 0.25
61 0.24
62 0.26
63 0.3
64 0.3
65 0.36