Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G4NVG6

Protein Details
Accession A0A0G4NVG6    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MHANTSKKIYRKLNKRRLRTYPHPEYGVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 10, mito 7, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MHANTSKKIYRKLNKRRLRTYPHPEYGVPRSESAEIMEHFRYAWDQPKSSPRRGASAAPELAYPIKSPIDFPISIHFSAVSLDWTLNRSPLLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.88
3 0.89
4 0.88
5 0.88
6 0.87
7 0.86
8 0.85
9 0.81
10 0.74
11 0.66
12 0.61
13 0.57
14 0.52
15 0.43
16 0.34
17 0.3
18 0.28
19 0.26
20 0.22
21 0.2
22 0.15
23 0.16
24 0.15
25 0.13
26 0.12
27 0.12
28 0.12
29 0.1
30 0.17
31 0.16
32 0.17
33 0.19
34 0.29
35 0.34
36 0.37
37 0.42
38 0.35
39 0.38
40 0.39
41 0.4
42 0.35
43 0.36
44 0.33
45 0.27
46 0.26
47 0.23
48 0.21
49 0.18
50 0.14
51 0.1
52 0.1
53 0.1
54 0.11
55 0.13
56 0.18
57 0.17
58 0.18
59 0.23
60 0.26
61 0.26
62 0.25
63 0.22
64 0.17
65 0.17
66 0.17
67 0.11
68 0.08
69 0.09
70 0.1
71 0.12
72 0.13
73 0.14