Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G4PXR1

Protein Details
Accession A0A0G4PXR1    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
41-66LRGLSVRCRRCRPRRFQRKLLETCSVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 8.5, cyto_nucl 8, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MVTLTWPVDWHVCQLWQSSRLPASFSSLANTHRLPRLDPLLRGLSVRCRRCRPRRFQRKLLETCSVHKVDHVAGGLYIQDNVSLGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.25
3 0.26
4 0.27
5 0.28
6 0.28
7 0.27
8 0.28
9 0.23
10 0.26
11 0.24
12 0.23
13 0.21
14 0.2
15 0.21
16 0.23
17 0.23
18 0.2
19 0.21
20 0.22
21 0.21
22 0.22
23 0.28
24 0.27
25 0.26
26 0.27
27 0.25
28 0.25
29 0.24
30 0.21
31 0.23
32 0.29
33 0.35
34 0.36
35 0.43
36 0.53
37 0.63
38 0.73
39 0.74
40 0.78
41 0.83
42 0.87
43 0.89
44 0.89
45 0.89
46 0.86
47 0.81
48 0.78
49 0.68
50 0.63
51 0.59
52 0.51
53 0.4
54 0.34
55 0.3
56 0.22
57 0.23
58 0.2
59 0.14
60 0.12
61 0.12
62 0.12
63 0.11
64 0.1
65 0.07
66 0.07