Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G4P1H3

Protein Details
Accession A0A0G4P1H3   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
260-285PDLREIRKMIRQQQKREKERQQQASNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007715  Coq4  
IPR027540  Coq4_euk  
Gene Ontology GO:0031314  C:extrinsic component of mitochondrial inner membrane  
GO:0006744  P:ubiquinone biosynthetic process  
Pfam View protein in Pfam  
PF05019  Coq4  
Amino Acid Sequences MSVLGRRGAIELRALAATPNLSAASTLRPFSVLNRPPPNYPGHVPLTTIERGALALGSAIGSLINPRRADLIAALGEATATPFFIYRLRDAMLSDPTGRRILRDRPRITSETLKMAHLRTLPENSVGRTYAKWLDREGVSPDTRDNVQYIDNEECAYVMQRYRECHDFYHAVTGLPIFVEGELALKALEFLNTLLPMTGLSLFAFVRMKPAEKERFLSLHLPWAIRSGLGSKELINVYWEEVLEKDVDELRAELNIERPPDLREIRKMIRQQQKREKERQQQASN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.14
3 0.14
4 0.13
5 0.1
6 0.1
7 0.09
8 0.08
9 0.09
10 0.1
11 0.15
12 0.17
13 0.17
14 0.16
15 0.17
16 0.18
17 0.22
18 0.31
19 0.31
20 0.39
21 0.47
22 0.49
23 0.51
24 0.54
25 0.54
26 0.49
27 0.46
28 0.42
29 0.39
30 0.37
31 0.35
32 0.33
33 0.34
34 0.29
35 0.26
36 0.2
37 0.14
38 0.14
39 0.13
40 0.11
41 0.05
42 0.05
43 0.04
44 0.04
45 0.04
46 0.04
47 0.03
48 0.03
49 0.07
50 0.11
51 0.16
52 0.16
53 0.16
54 0.19
55 0.19
56 0.2
57 0.17
58 0.17
59 0.12
60 0.12
61 0.11
62 0.09
63 0.09
64 0.08
65 0.08
66 0.04
67 0.04
68 0.04
69 0.04
70 0.05
71 0.08
72 0.1
73 0.11
74 0.13
75 0.14
76 0.14
77 0.15
78 0.17
79 0.17
80 0.16
81 0.18
82 0.16
83 0.18
84 0.21
85 0.2
86 0.19
87 0.22
88 0.3
89 0.37
90 0.47
91 0.48
92 0.5
93 0.56
94 0.56
95 0.55
96 0.52
97 0.45
98 0.41
99 0.38
100 0.34
101 0.3
102 0.28
103 0.27
104 0.22
105 0.22
106 0.18
107 0.19
108 0.18
109 0.21
110 0.21
111 0.19
112 0.19
113 0.18
114 0.16
115 0.14
116 0.16
117 0.18
118 0.19
119 0.19
120 0.18
121 0.21
122 0.2
123 0.21
124 0.22
125 0.2
126 0.18
127 0.18
128 0.17
129 0.16
130 0.16
131 0.15
132 0.12
133 0.09
134 0.1
135 0.1
136 0.12
137 0.12
138 0.12
139 0.11
140 0.11
141 0.1
142 0.08
143 0.08
144 0.07
145 0.07
146 0.1
147 0.12
148 0.14
149 0.18
150 0.21
151 0.22
152 0.22
153 0.26
154 0.25
155 0.23
156 0.27
157 0.24
158 0.2
159 0.19
160 0.17
161 0.13
162 0.11
163 0.1
164 0.04
165 0.03
166 0.03
167 0.03
168 0.04
169 0.04
170 0.04
171 0.04
172 0.04
173 0.04
174 0.04
175 0.05
176 0.04
177 0.05
178 0.06
179 0.06
180 0.07
181 0.06
182 0.06
183 0.06
184 0.06
185 0.06
186 0.05
187 0.05
188 0.07
189 0.06
190 0.08
191 0.09
192 0.08
193 0.13
194 0.13
195 0.16
196 0.17
197 0.26
198 0.32
199 0.34
200 0.37
201 0.36
202 0.36
203 0.37
204 0.38
205 0.3
206 0.3
207 0.3
208 0.28
209 0.24
210 0.25
211 0.22
212 0.19
213 0.19
214 0.13
215 0.13
216 0.14
217 0.15
218 0.13
219 0.17
220 0.17
221 0.17
222 0.16
223 0.15
224 0.14
225 0.15
226 0.14
227 0.11
228 0.1
229 0.11
230 0.1
231 0.1
232 0.1
233 0.11
234 0.12
235 0.12
236 0.12
237 0.11
238 0.12
239 0.13
240 0.12
241 0.14
242 0.17
243 0.18
244 0.19
245 0.2
246 0.21
247 0.28
248 0.33
249 0.34
250 0.38
251 0.44
252 0.49
253 0.56
254 0.62
255 0.64
256 0.69
257 0.73
258 0.77
259 0.8
260 0.85
261 0.86
262 0.89
263 0.9
264 0.9
265 0.91