Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0G4NT69

Protein Details
Accession A0A0G4NT69    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
53-73PDDNALPQPSRRRRRRRQRHABasic
NLS Segment(s)
PositionSequence
62-73SRRRRRRRQRHA
Subcellular Location(s) nucl 19, cyto 4, mito 2, extr 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences MSSSSTPFSALAPVFVPGRLAEQDDLQSGPPSPTPLFANVGIDPPADCGTTTPDDNALPQPSRRRRRRRQRHA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.13
4 0.09
5 0.12
6 0.11
7 0.13
8 0.12
9 0.12
10 0.13
11 0.13
12 0.14
13 0.12
14 0.11
15 0.1
16 0.1
17 0.09
18 0.11
19 0.1
20 0.11
21 0.12
22 0.12
23 0.14
24 0.14
25 0.15
26 0.13
27 0.14
28 0.12
29 0.11
30 0.1
31 0.09
32 0.1
33 0.08
34 0.08
35 0.07
36 0.11
37 0.14
38 0.14
39 0.13
40 0.14
41 0.14
42 0.16
43 0.19
44 0.2
45 0.2
46 0.25
47 0.35
48 0.44
49 0.54
50 0.63
51 0.71
52 0.78
53 0.87