Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G4PKQ2

Protein Details
Accession A0A0G4PKQ2    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
12-42APPAPSNSQKVTKRRRPRGGKKIRPKGTEKABasic
NLS Segment(s)
PositionSequence
22-38VTKRRRPRGGKKIRPKG
Subcellular Location(s) mito 19, nucl 5, cyto 2
Family & Domain DBs
Amino Acid Sequences MSEKNNTPATVAPPAPSNSQKVTKRRRPRGGKKIRPKGTEKALLAVAEAGSVAGTEVAARPASYQAPSLLAASLPKPVLLSNANIRINIASTGVAAPAVGLAHQITIASLVPGLNLSEGEVHALAAYLPHIIAGFVQGRRAAGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.33
3 0.33
4 0.33
5 0.32
6 0.4
7 0.47
8 0.53
9 0.61
10 0.67
11 0.75
12 0.81
13 0.87
14 0.89
15 0.92
16 0.93
17 0.94
18 0.94
19 0.94
20 0.94
21 0.92
22 0.88
23 0.82
24 0.79
25 0.76
26 0.73
27 0.62
28 0.54
29 0.46
30 0.39
31 0.33
32 0.26
33 0.17
34 0.09
35 0.08
36 0.05
37 0.03
38 0.03
39 0.03
40 0.02
41 0.02
42 0.02
43 0.03
44 0.04
45 0.04
46 0.04
47 0.05
48 0.06
49 0.08
50 0.08
51 0.08
52 0.08
53 0.09
54 0.1
55 0.09
56 0.08
57 0.07
58 0.07
59 0.07
60 0.08
61 0.07
62 0.06
63 0.06
64 0.06
65 0.09
66 0.09
67 0.11
68 0.13
69 0.2
70 0.21
71 0.21
72 0.21
73 0.19
74 0.18
75 0.17
76 0.13
77 0.06
78 0.06
79 0.06
80 0.06
81 0.06
82 0.05
83 0.04
84 0.04
85 0.03
86 0.03
87 0.03
88 0.03
89 0.03
90 0.04
91 0.04
92 0.03
93 0.04
94 0.05
95 0.04
96 0.05
97 0.04
98 0.05
99 0.05
100 0.05
101 0.05
102 0.05
103 0.05
104 0.06
105 0.06
106 0.08
107 0.07
108 0.07
109 0.07
110 0.07
111 0.06
112 0.05
113 0.06
114 0.05
115 0.04
116 0.05
117 0.05
118 0.05
119 0.05
120 0.08
121 0.13
122 0.13
123 0.16
124 0.17