Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0G4PGF4

Protein Details
Accession A0A0G4PGF4    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
46-65VVRSKKRSEHWRKRLSTFKIHydrophilic
NLS Segment(s)
PositionSequence
49-57SKKRSEHWR
Subcellular Location(s) mito 11, nucl 9, cyto 4, pero 2
Family & Domain DBs
Amino Acid Sequences MAAVLEVAILETESRLYRDMGLWLDPAKGNAQMAIAIKANRTRQAVVRSKKRSEHWRKRLSTFKIQLTCFGMSSRQTTKMFEKATA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.1
4 0.11
5 0.12
6 0.14
7 0.14
8 0.14
9 0.14
10 0.14
11 0.15
12 0.14
13 0.14
14 0.13
15 0.12
16 0.11
17 0.1
18 0.09
19 0.09
20 0.1
21 0.11
22 0.11
23 0.1
24 0.12
25 0.15
26 0.17
27 0.19
28 0.19
29 0.19
30 0.22
31 0.3
32 0.38
33 0.42
34 0.5
35 0.54
36 0.56
37 0.6
38 0.63
39 0.66
40 0.68
41 0.72
42 0.73
43 0.76
44 0.77
45 0.79
46 0.81
47 0.77
48 0.76
49 0.72
50 0.69
51 0.65
52 0.61
53 0.58
54 0.53
55 0.47
56 0.37
57 0.31
58 0.25
59 0.21
60 0.26
61 0.26
62 0.29
63 0.29
64 0.33
65 0.37
66 0.43