Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G4PY06

Protein Details
Accession A0A0G4PY06    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
17-43NDNKLSRRSCYKEPKRNHKNILRTSKGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 7
Family & Domain DBs
Amino Acid Sequences MNLGPGDLKYQKDDSDNDNKLSRRSCYKEPKRNHKNILRTSKGLGDTLADAIGGLKEGNAPGFHFYKRAAIWKESAKIYLRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.38
3 0.4
4 0.39
5 0.42
6 0.42
7 0.42
8 0.43
9 0.4
10 0.38
11 0.41
12 0.47
13 0.53
14 0.63
15 0.68
16 0.75
17 0.82
18 0.84
19 0.87
20 0.87
21 0.83
22 0.82
23 0.82
24 0.81
25 0.74
26 0.65
27 0.57
28 0.52
29 0.45
30 0.35
31 0.26
32 0.17
33 0.13
34 0.12
35 0.1
36 0.06
37 0.05
38 0.05
39 0.05
40 0.04
41 0.03
42 0.03
43 0.04
44 0.04
45 0.05
46 0.06
47 0.07
48 0.1
49 0.13
50 0.13
51 0.14
52 0.15
53 0.19
54 0.21
55 0.29
56 0.3
57 0.3
58 0.35
59 0.41
60 0.45
61 0.42
62 0.44