Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G4PSS8

Protein Details
Accession A0A0G4PSS8    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MPRPSKIFSRNRKNRTRKEKDHPTPHCTPBasic
NLS Segment(s)
PositionSequence
10-18RNRKNRTRK
Subcellular Location(s) mito 21, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MPRPSKIFSRNRKNRTRKEKDHPTPHCTPAKTMTKVPVRLALWAECADATAHLCASMTIIAQCSFPRDIFGFTRVPETMISPTHSPDLIWI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.92
3 0.92
4 0.91
5 0.91
6 0.92
7 0.92
8 0.92
9 0.88
10 0.85
11 0.8
12 0.77
13 0.72
14 0.62
15 0.54
16 0.51
17 0.53
18 0.48
19 0.44
20 0.45
21 0.45
22 0.47
23 0.45
24 0.43
25 0.35
26 0.33
27 0.33
28 0.25
29 0.2
30 0.18
31 0.17
32 0.1
33 0.1
34 0.08
35 0.07
36 0.07
37 0.05
38 0.05
39 0.04
40 0.05
41 0.04
42 0.05
43 0.05
44 0.04
45 0.05
46 0.06
47 0.07
48 0.07
49 0.08
50 0.1
51 0.11
52 0.11
53 0.14
54 0.13
55 0.17
56 0.18
57 0.21
58 0.2
59 0.2
60 0.24
61 0.21
62 0.21
63 0.18
64 0.19
65 0.19
66 0.19
67 0.22
68 0.2
69 0.22
70 0.23
71 0.23