Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0G4NVI4

Protein Details
Accession A0A0G4NVI4    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
83-128ASEKISKQKTTKKTTKKTTKKTTKKTTKKTTKKTRLRQGRICSRLFHydrophilic
NLS Segment(s)
PositionSequence
89-119KQKTTKKTTKKTTKKTTKKTTKKTTKKTRLR
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, cyto 4.5, mito 4
Family & Domain DBs
Amino Acid Sequences MDGYPGAFENSGCGSNKFLYRAVEANWTAPQRRSWIQLWHQPWKYKYIFFHHANPNSWYLLDAISSFVELTLIIHKFWTWELASEKISKQKTTKKTTKKTTKKTTKKTTKKTTKKTRLRQGRICSRLFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.21
3 0.24
4 0.24
5 0.24
6 0.24
7 0.25
8 0.26
9 0.25
10 0.29
11 0.27
12 0.26
13 0.28
14 0.29
15 0.28
16 0.28
17 0.28
18 0.27
19 0.29
20 0.31
21 0.3
22 0.36
23 0.4
24 0.46
25 0.5
26 0.54
27 0.57
28 0.58
29 0.55
30 0.54
31 0.5
32 0.45
33 0.43
34 0.41
35 0.44
36 0.42
37 0.49
38 0.5
39 0.52
40 0.5
41 0.48
42 0.43
43 0.35
44 0.32
45 0.24
46 0.16
47 0.11
48 0.09
49 0.07
50 0.06
51 0.06
52 0.06
53 0.05
54 0.04
55 0.04
56 0.04
57 0.04
58 0.07
59 0.07
60 0.07
61 0.07
62 0.07
63 0.08
64 0.08
65 0.11
66 0.07
67 0.1
68 0.13
69 0.15
70 0.17
71 0.18
72 0.2
73 0.24
74 0.26
75 0.27
76 0.31
77 0.38
78 0.46
79 0.54
80 0.62
81 0.66
82 0.74
83 0.82
84 0.87
85 0.88
86 0.9
87 0.91
88 0.93
89 0.93
90 0.93
91 0.94
92 0.94
93 0.94
94 0.94
95 0.94
96 0.94
97 0.94
98 0.94
99 0.94
100 0.94
101 0.94
102 0.94
103 0.94
104 0.94
105 0.94
106 0.92
107 0.91
108 0.91
109 0.87