Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G4PYY6

Protein Details
Accession A0A0G4PYY6   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
7-36RSNGSSSKRKSMRQKQGRRKSNLMKKAREYHydrophilic
NLS Segment(s)
PositionSequence
13-33SKRKSMRQKQGRRKSNLMKKA
Subcellular Location(s) mito 18, nucl 5.5, cyto_nucl 5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0006351  P:DNA-templated transcription  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
PROSITE View protein in PROSITE  
PS50066  MADS_BOX_2  
Amino Acid Sequences MATTGPRSNGSSSKRKSMRQKQGRRKSNLMKKAREYSRLCEADVCVGIRLRETGQVFILSADASGFWGFLGSQLASYYPTPFLIMDQDLEKAEEGIIRKPSEANLLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.63
3 0.7
4 0.74
5 0.78
6 0.79
7 0.86
8 0.87
9 0.92
10 0.93
11 0.9
12 0.88
13 0.88
14 0.87
15 0.86
16 0.84
17 0.8
18 0.77
19 0.79
20 0.73
21 0.72
22 0.65
23 0.59
24 0.6
25 0.54
26 0.48
27 0.39
28 0.35
29 0.28
30 0.25
31 0.21
32 0.12
33 0.11
34 0.11
35 0.1
36 0.1
37 0.08
38 0.11
39 0.12
40 0.11
41 0.11
42 0.11
43 0.11
44 0.1
45 0.1
46 0.06
47 0.05
48 0.04
49 0.03
50 0.04
51 0.04
52 0.04
53 0.03
54 0.03
55 0.03
56 0.04
57 0.06
58 0.05
59 0.06
60 0.06
61 0.06
62 0.08
63 0.09
64 0.1
65 0.09
66 0.1
67 0.1
68 0.1
69 0.11
70 0.11
71 0.12
72 0.12
73 0.12
74 0.13
75 0.13
76 0.14
77 0.13
78 0.11
79 0.1
80 0.11
81 0.12
82 0.16
83 0.21
84 0.21
85 0.22
86 0.22
87 0.24