Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G4P9L7

Protein Details
Accession A0A0G4P9L7   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
15-39IANSKFKTSHARRGNQKSLRRRETLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
Amino Acid Sequences MEPSPVVNISLPTNIANSKFKTSHARRGNQKSLRRRETLLKKIFEYCTECDADIHFVLRMKKTGQLYTLTSNAKEWPLSTEQINKESNHPEPIQMKMDELAIKYQGQSPQGEHRPMSLLKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.19
3 0.23
4 0.24
5 0.29
6 0.28
7 0.31
8 0.4
9 0.45
10 0.51
11 0.56
12 0.61
13 0.65
14 0.74
15 0.8
16 0.78
17 0.81
18 0.81
19 0.83
20 0.81
21 0.74
22 0.68
23 0.68
24 0.69
25 0.7
26 0.67
27 0.59
28 0.55
29 0.56
30 0.53
31 0.46
32 0.41
33 0.32
34 0.27
35 0.25
36 0.24
37 0.19
38 0.19
39 0.17
40 0.13
41 0.11
42 0.09
43 0.11
44 0.12
45 0.13
46 0.14
47 0.12
48 0.16
49 0.18
50 0.18
51 0.18
52 0.18
53 0.2
54 0.21
55 0.25
56 0.22
57 0.2
58 0.2
59 0.19
60 0.17
61 0.15
62 0.13
63 0.12
64 0.14
65 0.15
66 0.16
67 0.22
68 0.24
69 0.28
70 0.31
71 0.28
72 0.29
73 0.32
74 0.33
75 0.31
76 0.29
77 0.3
78 0.29
79 0.32
80 0.32
81 0.28
82 0.27
83 0.22
84 0.24
85 0.21
86 0.2
87 0.18
88 0.16
89 0.16
90 0.16
91 0.2
92 0.21
93 0.22
94 0.22
95 0.24
96 0.32
97 0.39
98 0.42
99 0.38
100 0.36
101 0.39