Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G4NSW0

Protein Details
Accession A0A0G4NSW0    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
198-223VTYKRTQLEAPPKGKRRKCREAKEVEHydrophilic
NLS Segment(s)
PositionSequence
209-215PKGKRRK
Subcellular Location(s) nucl 17.5, cyto_nucl 12, mito 6
Family & Domain DBs
Amino Acid Sequences MPSVKPILPPLKTPKTEIFPSQLHNGSTSSVSDYIKQEDLSTPITPPTAYTDFLKALTPVFTGPMSAGLSFPKYIGDKASSATSPTSQPASAFSGSTFSDSVRSPTVSLPPPTPNSAAPSRKSFHGRRLRIQSALKFSPSADSPRSATPRSATPWSAAPKSATTLRSPFSPSDWTLRYYDSPRSAKPVSVKQVVTRTVTYKRTQLEAPPKGKRRKCREAKEVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.56
3 0.58
4 0.55
5 0.51
6 0.44
7 0.46
8 0.48
9 0.44
10 0.38
11 0.35
12 0.31
13 0.27
14 0.25
15 0.22
16 0.18
17 0.17
18 0.17
19 0.2
20 0.21
21 0.23
22 0.24
23 0.23
24 0.21
25 0.2
26 0.22
27 0.22
28 0.2
29 0.17
30 0.17
31 0.17
32 0.15
33 0.14
34 0.18
35 0.17
36 0.18
37 0.19
38 0.21
39 0.21
40 0.22
41 0.22
42 0.16
43 0.14
44 0.13
45 0.12
46 0.09
47 0.1
48 0.09
49 0.08
50 0.08
51 0.09
52 0.09
53 0.09
54 0.09
55 0.09
56 0.1
57 0.1
58 0.1
59 0.1
60 0.1
61 0.11
62 0.12
63 0.14
64 0.13
65 0.14
66 0.16
67 0.14
68 0.14
69 0.15
70 0.14
71 0.13
72 0.14
73 0.14
74 0.12
75 0.12
76 0.13
77 0.15
78 0.14
79 0.13
80 0.12
81 0.12
82 0.12
83 0.14
84 0.11
85 0.08
86 0.1
87 0.1
88 0.12
89 0.11
90 0.11
91 0.11
92 0.12
93 0.16
94 0.17
95 0.18
96 0.18
97 0.2
98 0.22
99 0.22
100 0.23
101 0.19
102 0.2
103 0.26
104 0.27
105 0.27
106 0.29
107 0.29
108 0.31
109 0.38
110 0.36
111 0.4
112 0.46
113 0.48
114 0.51
115 0.59
116 0.58
117 0.56
118 0.58
119 0.52
120 0.49
121 0.46
122 0.39
123 0.31
124 0.28
125 0.25
126 0.22
127 0.22
128 0.17
129 0.17
130 0.18
131 0.24
132 0.28
133 0.27
134 0.27
135 0.24
136 0.27
137 0.29
138 0.31
139 0.26
140 0.24
141 0.28
142 0.32
143 0.31
144 0.28
145 0.26
146 0.23
147 0.25
148 0.28
149 0.24
150 0.23
151 0.25
152 0.25
153 0.25
154 0.28
155 0.25
156 0.24
157 0.26
158 0.25
159 0.28
160 0.29
161 0.29
162 0.27
163 0.3
164 0.31
165 0.3
166 0.35
167 0.37
168 0.39
169 0.38
170 0.43
171 0.42
172 0.42
173 0.45
174 0.47
175 0.46
176 0.49
177 0.49
178 0.48
179 0.53
180 0.53
181 0.5
182 0.43
183 0.41
184 0.42
185 0.46
186 0.43
187 0.43
188 0.42
189 0.42
190 0.42
191 0.46
192 0.5
193 0.54
194 0.59
195 0.63
196 0.7
197 0.77
198 0.83
199 0.84
200 0.83
201 0.85
202 0.87
203 0.88