Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G4PI57

Protein Details
Accession A0A0G4PI57   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
8-40PLYPPYKDATSKRKKMRQKQCRRKTSLMKKGYEHydrophilic
NLS Segment(s)
PositionSequence
19-26KRKKMRQK
Subcellular Location(s) nucl 19, cyto_nucl 12, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
Amino Acid Sequences MSQSVNGPLYPPYKDATSKRKKMRQKQCRRKTSLMKKGYEYSKMCSADVCVGISIRDTGQVHILSADSSGFWAFLGSQLNSYYPAPRPNTSDRPGSSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.35
3 0.42
4 0.5
5 0.58
6 0.66
7 0.73
8 0.8
9 0.85
10 0.89
11 0.89
12 0.9
13 0.92
14 0.92
15 0.94
16 0.91
17 0.9
18 0.9
19 0.9
20 0.88
21 0.85
22 0.77
23 0.7
24 0.68
25 0.61
26 0.58
27 0.48
28 0.42
29 0.41
30 0.38
31 0.35
32 0.28
33 0.26
34 0.21
35 0.2
36 0.16
37 0.09
38 0.08
39 0.08
40 0.08
41 0.07
42 0.05
43 0.08
44 0.08
45 0.09
46 0.12
47 0.12
48 0.12
49 0.12
50 0.12
51 0.08
52 0.08
53 0.08
54 0.04
55 0.05
56 0.05
57 0.04
58 0.04
59 0.04
60 0.04
61 0.06
62 0.1
63 0.1
64 0.11
65 0.12
66 0.13
67 0.15
68 0.16
69 0.17
70 0.18
71 0.25
72 0.29
73 0.31
74 0.37
75 0.43
76 0.51
77 0.51
78 0.56