Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G4PWY4

Protein Details
Accession A0A0G4PWY4   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
85-112DYKGLDVLSHKKKRNKAKANKATTKDMAHydrophilic
NLS Segment(s)
PositionSequence
94-105HKKKRNKAKANK
Subcellular Location(s) nucl 15, cyto_nucl 12.5, cyto 8, cysk 3
Family & Domain DBs
Amino Acid Sequences MEENLQSLTAGKVQELLIICGIGDCNDEPIKQHILGISDFVREMRLWVGIIDLPPLLTPRASPNPEVMRGSYRFLPTPEKRSRADYKGLDVLSHKKKRNKAKANKATTKDMA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.15
4 0.13
5 0.12
6 0.12
7 0.1
8 0.1
9 0.07
10 0.08
11 0.06
12 0.1
13 0.11
14 0.11
15 0.13
16 0.16
17 0.19
18 0.17
19 0.18
20 0.15
21 0.17
22 0.17
23 0.17
24 0.14
25 0.11
26 0.11
27 0.11
28 0.11
29 0.08
30 0.09
31 0.07
32 0.07
33 0.07
34 0.07
35 0.07
36 0.07
37 0.07
38 0.07
39 0.06
40 0.05
41 0.05
42 0.06
43 0.05
44 0.05
45 0.05
46 0.1
47 0.16
48 0.18
49 0.19
50 0.24
51 0.27
52 0.29
53 0.3
54 0.26
55 0.24
56 0.24
57 0.26
58 0.24
59 0.22
60 0.21
61 0.23
62 0.31
63 0.31
64 0.38
65 0.44
66 0.45
67 0.45
68 0.51
69 0.56
70 0.52
71 0.56
72 0.49
73 0.46
74 0.48
75 0.46
76 0.4
77 0.36
78 0.4
79 0.42
80 0.48
81 0.51
82 0.53
83 0.62
84 0.72
85 0.8
86 0.82
87 0.83
88 0.86
89 0.89
90 0.92
91 0.93
92 0.87