Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0G4PR45

Protein Details
Accession A0A0G4PR45    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
5-26ICTYRRMPRRSGNQNMHRRPQDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, mito_nucl 14, nucl 8
Family & Domain DBs
Amino Acid Sequences MKVTICTYRRMPRRSGNQNMHRRPQDGKAGAWWRGWKTYNWPSSSTRAALGLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.75
3 0.76
4 0.77
5 0.83
6 0.83
7 0.82
8 0.75
9 0.67
10 0.59
11 0.54
12 0.52
13 0.43
14 0.36
15 0.35
16 0.36
17 0.36
18 0.35
19 0.34
20 0.27
21 0.3
22 0.31
23 0.26
24 0.31
25 0.38
26 0.43
27 0.42
28 0.45
29 0.44
30 0.48
31 0.5
32 0.43
33 0.35