Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6BUM6

Protein Details
Accession Q6BUM6   
Localization Confidence Low
Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
199-223SHGYYNRKGKTKAFKRKPYVENVGDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19.5, mito_nucl 14, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010487  NGRN/Rrg9  
Gene Ontology GO:0005739  C:mitochondrion  
KEGG dha:DEHA2C09482g  -  
Pfam View protein in Pfam  
PF06413  Neugrin  
Amino Acid Sequences MFRVLIPSRKLVPGCGGFMGGIARIQAYSTKKDKSEEIFKTKIQQREKEAQQKLPEWTKRDEAIRNRYGEWNPTHRLSRQQIQDIRNIKDKMPHMKTIELANHFKISPEAIRRILKSTWVPSDSEEERIRLRGEKRKDESLVHKKEMMNDIELARKRLTYGKSVTMGGINVPRSGGRKGKNLRNTFSTDGKVNFDSNNSHGYYNRKGKTKAFKRKPYVENVGDIID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.31
3 0.28
4 0.22
5 0.22
6 0.2
7 0.13
8 0.1
9 0.08
10 0.07
11 0.06
12 0.07
13 0.12
14 0.15
15 0.22
16 0.27
17 0.32
18 0.34
19 0.37
20 0.41
21 0.43
22 0.5
23 0.51
24 0.53
25 0.53
26 0.52
27 0.59
28 0.6
29 0.61
30 0.59
31 0.57
32 0.57
33 0.62
34 0.7
35 0.71
36 0.69
37 0.67
38 0.65
39 0.62
40 0.61
41 0.61
42 0.57
43 0.51
44 0.5
45 0.48
46 0.46
47 0.48
48 0.49
49 0.49
50 0.52
51 0.54
52 0.52
53 0.49
54 0.51
55 0.48
56 0.46
57 0.42
58 0.39
59 0.37
60 0.38
61 0.39
62 0.35
63 0.42
64 0.41
65 0.44
66 0.42
67 0.47
68 0.5
69 0.49
70 0.55
71 0.53
72 0.5
73 0.51
74 0.47
75 0.39
76 0.39
77 0.41
78 0.43
79 0.42
80 0.44
81 0.38
82 0.38
83 0.39
84 0.37
85 0.37
86 0.31
87 0.29
88 0.25
89 0.24
90 0.22
91 0.21
92 0.17
93 0.14
94 0.13
95 0.14
96 0.16
97 0.19
98 0.21
99 0.22
100 0.25
101 0.24
102 0.24
103 0.23
104 0.23
105 0.23
106 0.22
107 0.22
108 0.2
109 0.25
110 0.22
111 0.25
112 0.22
113 0.2
114 0.2
115 0.21
116 0.2
117 0.2
118 0.25
119 0.29
120 0.35
121 0.43
122 0.47
123 0.51
124 0.52
125 0.51
126 0.56
127 0.58
128 0.57
129 0.5
130 0.5
131 0.46
132 0.48
133 0.48
134 0.39
135 0.3
136 0.26
137 0.25
138 0.27
139 0.28
140 0.26
141 0.21
142 0.2
143 0.19
144 0.24
145 0.25
146 0.24
147 0.27
148 0.29
149 0.31
150 0.31
151 0.3
152 0.25
153 0.23
154 0.19
155 0.2
156 0.15
157 0.13
158 0.13
159 0.14
160 0.16
161 0.2
162 0.25
163 0.25
164 0.34
165 0.42
166 0.51
167 0.6
168 0.64
169 0.64
170 0.62
171 0.64
172 0.59
173 0.56
174 0.49
175 0.43
176 0.39
177 0.38
178 0.35
179 0.3
180 0.27
181 0.25
182 0.25
183 0.23
184 0.25
185 0.23
186 0.22
187 0.24
188 0.29
189 0.37
190 0.43
191 0.47
192 0.5
193 0.52
194 0.6
195 0.68
196 0.73
197 0.75
198 0.76
199 0.81
200 0.83
201 0.9
202 0.88
203 0.86
204 0.85
205 0.77
206 0.7