Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L6WKU6

Protein Details
Accession A0A0L6WKU6    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
120-142IPTFPQGKTKRNSRQNVRFETEAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021109  Peptidase_aspartic_dom_sf  
Pfam View protein in Pfam  
PF13975  gag-asp_proteas  
CDD cd00303  retropepsin_like  
Amino Acid Sequences MMLIDNKEEVECIHDSGSQISSMSAEIASDIGLSYDPNIVLNMQSANGTMDQSLGLARNVPCMIGDVTVYLQIHVLQSPAYDILLGHPFDVLTRSMVNTISDIETTITITDPNTGLRRTIPTFPQGKTKRNSRQNVRFETEAPRCFHRPRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.17
4 0.17
5 0.14
6 0.13
7 0.11
8 0.11
9 0.09
10 0.09
11 0.07
12 0.06
13 0.06
14 0.05
15 0.05
16 0.05
17 0.04
18 0.04
19 0.04
20 0.04
21 0.05
22 0.06
23 0.06
24 0.07
25 0.07
26 0.07
27 0.07
28 0.08
29 0.08
30 0.07
31 0.07
32 0.07
33 0.07
34 0.08
35 0.08
36 0.06
37 0.06
38 0.06
39 0.06
40 0.06
41 0.06
42 0.05
43 0.08
44 0.08
45 0.11
46 0.11
47 0.11
48 0.1
49 0.11
50 0.11
51 0.08
52 0.08
53 0.06
54 0.07
55 0.08
56 0.08
57 0.07
58 0.06
59 0.06
60 0.07
61 0.06
62 0.06
63 0.04
64 0.04
65 0.05
66 0.05
67 0.04
68 0.04
69 0.04
70 0.05
71 0.08
72 0.09
73 0.08
74 0.08
75 0.08
76 0.08
77 0.1
78 0.08
79 0.06
80 0.07
81 0.07
82 0.08
83 0.09
84 0.09
85 0.08
86 0.09
87 0.09
88 0.08
89 0.08
90 0.08
91 0.08
92 0.08
93 0.08
94 0.06
95 0.06
96 0.06
97 0.07
98 0.07
99 0.11
100 0.13
101 0.13
102 0.14
103 0.16
104 0.21
105 0.23
106 0.27
107 0.27
108 0.32
109 0.36
110 0.37
111 0.46
112 0.47
113 0.52
114 0.54
115 0.62
116 0.65
117 0.7
118 0.79
119 0.79
120 0.83
121 0.85
122 0.86
123 0.82
124 0.74
125 0.66
126 0.66
127 0.63
128 0.59
129 0.52
130 0.5
131 0.49