Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6WAT5

Protein Details
Accession A0A0L6WAT5   
Localization Confidence Medium
Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
4-23LLPPNPRPIHPPNKMRRTATHydrophilic
181-208EDPLPPPQPKPRGRKKPAVRKGWKGWVEBasic
NLS Segment(s)
PositionSequence
60-69RKAEKRKRKE
188-204QPKPRGRKKPAVRKGWK
Subcellular Location(s) mito 19, nucl 7
Family & Domain DBs
Amino Acid Sequences MVPLLPPNPRPIHPPNKMRRTATAVMAGVFDVRPPRDAFTCLLNGVPRYKPVENEDESARKAEKRKRKEQAVAAAAKRVSALDAAKLDAATATSYTNQRIDIPHTKTSGFWPVEPLASSAVRPSSARPRIELKTAQRSVSVTPPPTSPTLFLSTPASTPGPSDSSSTSRMSSKRPHTPDDEDPLPPPQPKPRGRKKPAVRKGWKGWVEGSPPPSEKLINLDAVPVLQERRTRSGKSFDAIGIGKEGWV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.7
3 0.76
4 0.82
5 0.78
6 0.75
7 0.73
8 0.67
9 0.6
10 0.56
11 0.46
12 0.39
13 0.35
14 0.29
15 0.22
16 0.17
17 0.15
18 0.13
19 0.13
20 0.15
21 0.16
22 0.2
23 0.21
24 0.24
25 0.23
26 0.24
27 0.25
28 0.23
29 0.23
30 0.22
31 0.22
32 0.24
33 0.24
34 0.23
35 0.27
36 0.27
37 0.29
38 0.32
39 0.37
40 0.36
41 0.37
42 0.39
43 0.37
44 0.36
45 0.35
46 0.32
47 0.29
48 0.34
49 0.4
50 0.46
51 0.52
52 0.61
53 0.68
54 0.76
55 0.79
56 0.79
57 0.79
58 0.77
59 0.74
60 0.64
61 0.58
62 0.49
63 0.4
64 0.33
65 0.23
66 0.16
67 0.11
68 0.11
69 0.1
70 0.1
71 0.11
72 0.11
73 0.11
74 0.1
75 0.08
76 0.08
77 0.05
78 0.05
79 0.05
80 0.07
81 0.09
82 0.1
83 0.11
84 0.11
85 0.12
86 0.13
87 0.19
88 0.25
89 0.29
90 0.3
91 0.31
92 0.31
93 0.3
94 0.31
95 0.33
96 0.26
97 0.21
98 0.21
99 0.2
100 0.2
101 0.2
102 0.18
103 0.12
104 0.11
105 0.11
106 0.09
107 0.08
108 0.08
109 0.08
110 0.1
111 0.18
112 0.24
113 0.24
114 0.26
115 0.31
116 0.32
117 0.36
118 0.39
119 0.35
120 0.39
121 0.41
122 0.39
123 0.34
124 0.34
125 0.31
126 0.32
127 0.3
128 0.21
129 0.21
130 0.21
131 0.22
132 0.23
133 0.21
134 0.17
135 0.16
136 0.18
137 0.17
138 0.18
139 0.19
140 0.18
141 0.17
142 0.18
143 0.16
144 0.12
145 0.12
146 0.13
147 0.12
148 0.12
149 0.14
150 0.14
151 0.17
152 0.2
153 0.21
154 0.2
155 0.23
156 0.24
157 0.28
158 0.34
159 0.39
160 0.46
161 0.49
162 0.52
163 0.53
164 0.58
165 0.58
166 0.57
167 0.52
168 0.44
169 0.41
170 0.4
171 0.37
172 0.32
173 0.3
174 0.31
175 0.37
176 0.45
177 0.54
178 0.62
179 0.7
180 0.76
181 0.83
182 0.86
183 0.87
184 0.88
185 0.89
186 0.87
187 0.85
188 0.86
189 0.85
190 0.78
191 0.69
192 0.63
193 0.58
194 0.54
195 0.49
196 0.44
197 0.39
198 0.36
199 0.35
200 0.33
201 0.28
202 0.24
203 0.25
204 0.25
205 0.22
206 0.2
207 0.2
208 0.18
209 0.17
210 0.18
211 0.14
212 0.13
213 0.14
214 0.18
215 0.22
216 0.3
217 0.35
218 0.38
219 0.42
220 0.49
221 0.49
222 0.48
223 0.47
224 0.39
225 0.4
226 0.36
227 0.32
228 0.26