Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6BLG4

Protein Details
Accession Q6BLG4    Localization Confidence High Confidence Score 16.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MPSRNSINKPKDKLQRNSHASSHydrophilic
78-97LSNKRSKKIARNKKYIAKRNHydrophilic
NLS Segment(s)
PositionSequence
25-29KKRSA
81-96KRSKKIARNKKYIAKR
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR022784  Ribosome_bgen_Alb1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
KEGG dha:DEHA2F13640g  -  
Pfam View protein in Pfam  
PF09135  Alb1  
Amino Acid Sequences MPSRNSINKPKDKLQRNSHASSIGKKRSARARNGIVTKSSTPRYETDSNAAPKATESKAIALYNGATTPTGVIINNTLSNKRSKKIARNKKYIAKRNEKLNIDLLADQEQMEVDEETEKEEQTKAKNQTKLDKIKEVLWAAVEDRVSEGLKVSSGTDGNGTTLGVQAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.82
3 0.8
4 0.78
5 0.71
6 0.68
7 0.6
8 0.59
9 0.58
10 0.55
11 0.54
12 0.51
13 0.56
14 0.59
15 0.65
16 0.64
17 0.63
18 0.64
19 0.66
20 0.7
21 0.65
22 0.57
23 0.53
24 0.48
25 0.45
26 0.4
27 0.34
28 0.31
29 0.3
30 0.35
31 0.34
32 0.33
33 0.32
34 0.35
35 0.36
36 0.34
37 0.32
38 0.25
39 0.22
40 0.24
41 0.21
42 0.17
43 0.15
44 0.16
45 0.19
46 0.19
47 0.19
48 0.15
49 0.14
50 0.12
51 0.11
52 0.09
53 0.06
54 0.06
55 0.06
56 0.06
57 0.06
58 0.05
59 0.05
60 0.06
61 0.07
62 0.1
63 0.1
64 0.11
65 0.11
66 0.18
67 0.2
68 0.2
69 0.27
70 0.3
71 0.39
72 0.49
73 0.59
74 0.62
75 0.69
76 0.74
77 0.76
78 0.8
79 0.79
80 0.78
81 0.77
82 0.73
83 0.72
84 0.74
85 0.67
86 0.59
87 0.54
88 0.45
89 0.37
90 0.32
91 0.24
92 0.18
93 0.17
94 0.14
95 0.1
96 0.09
97 0.07
98 0.08
99 0.07
100 0.05
101 0.06
102 0.07
103 0.09
104 0.1
105 0.1
106 0.1
107 0.11
108 0.14
109 0.17
110 0.25
111 0.32
112 0.39
113 0.45
114 0.48
115 0.56
116 0.63
117 0.68
118 0.65
119 0.63
120 0.57
121 0.55
122 0.57
123 0.49
124 0.4
125 0.31
126 0.27
127 0.21
128 0.21
129 0.19
130 0.12
131 0.12
132 0.13
133 0.13
134 0.12
135 0.12
136 0.1
137 0.1
138 0.11
139 0.11
140 0.12
141 0.12
142 0.12
143 0.13
144 0.13
145 0.13
146 0.13
147 0.12
148 0.09