Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L6WFW1

Protein Details
Accession A0A0L6WFW1    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
59-79RHEKKGVKRRRLSSERWRKQFBasic
NLS Segment(s)
PositionSequence
59-96RHEKKGVKRRRLSSERWRKQFAHEVRKKVQLVAKIRNR
Subcellular Location(s) nucl 17, mito_nucl 11.833, cyto_nucl 11.333, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001911  Ribosomal_S21  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01165  Ribosomal_S21  
Amino Acid Sequences MWEKNSEMYLSSTRDNTPVHTFSGRSVLVKGGNVADAYGRLQSILQRNRVQAQLRLTERHEKKGVKRRRLSSERWRKQFAHEVRKKVQLVAKIRNRGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.27
4 0.29
5 0.27
6 0.28
7 0.28
8 0.27
9 0.24
10 0.29
11 0.26
12 0.2
13 0.19
14 0.18
15 0.17
16 0.17
17 0.17
18 0.11
19 0.12
20 0.11
21 0.1
22 0.08
23 0.07
24 0.07
25 0.07
26 0.06
27 0.05
28 0.06
29 0.09
30 0.17
31 0.21
32 0.26
33 0.29
34 0.3
35 0.32
36 0.36
37 0.34
38 0.29
39 0.28
40 0.3
41 0.29
42 0.3
43 0.31
44 0.37
45 0.38
46 0.4
47 0.43
48 0.41
49 0.48
50 0.56
51 0.63
52 0.63
53 0.7
54 0.71
55 0.76
56 0.78
57 0.78
58 0.79
59 0.81
60 0.8
61 0.79
62 0.77
63 0.68
64 0.68
65 0.7
66 0.69
67 0.68
68 0.66
69 0.67
70 0.66
71 0.74
72 0.68
73 0.63
74 0.58
75 0.55
76 0.56
77 0.58
78 0.62