Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6X2Q4

Protein Details
Accession A0A0L6X2Q4    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
95-123AAIPVPPRRIRQKKGPKRIKKRAAITIDQHydrophilic
NLS Segment(s)
PositionSequence
100-117PPRRIRQKKGPKRIKKRA
Subcellular Location(s) mito 11, cyto 8.5, cyto_nucl 8.5, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR035979  RBD_domain_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MAVVSFARPSDAMLAKQKYDGKVVDGRRPLKIELITEGTQLYGAQTGPPPTPSLLNRIGNPAKTQPSAANGVTSTIFPHAQKARSQMQIVPPPNAAIPVPPRRIRQKKGPKRIKKRAAITIDQLDKEMEDYRAAADMSGLTGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.31
3 0.37
4 0.4
5 0.36
6 0.37
7 0.34
8 0.3
9 0.35
10 0.39
11 0.41
12 0.45
13 0.45
14 0.45
15 0.47
16 0.43
17 0.4
18 0.38
19 0.31
20 0.27
21 0.3
22 0.27
23 0.24
24 0.23
25 0.18
26 0.16
27 0.14
28 0.11
29 0.06
30 0.06
31 0.06
32 0.08
33 0.1
34 0.1
35 0.11
36 0.12
37 0.12
38 0.15
39 0.15
40 0.19
41 0.23
42 0.25
43 0.25
44 0.31
45 0.32
46 0.29
47 0.3
48 0.28
49 0.25
50 0.23
51 0.24
52 0.18
53 0.19
54 0.21
55 0.19
56 0.16
57 0.13
58 0.13
59 0.12
60 0.12
61 0.09
62 0.07
63 0.09
64 0.08
65 0.13
66 0.15
67 0.17
68 0.19
69 0.24
70 0.27
71 0.29
72 0.31
73 0.29
74 0.33
75 0.39
76 0.39
77 0.36
78 0.31
79 0.28
80 0.27
81 0.25
82 0.18
83 0.12
84 0.18
85 0.24
86 0.3
87 0.33
88 0.39
89 0.49
90 0.58
91 0.62
92 0.66
93 0.7
94 0.74
95 0.81
96 0.87
97 0.87
98 0.9
99 0.95
100 0.94
101 0.92
102 0.89
103 0.87
104 0.83
105 0.77
106 0.72
107 0.69
108 0.64
109 0.54
110 0.47
111 0.38
112 0.3
113 0.27
114 0.23
115 0.16
116 0.12
117 0.12
118 0.12
119 0.14
120 0.14
121 0.12
122 0.1
123 0.09