Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6WVX7

Protein Details
Accession A0A0L6WVX7    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
96-134LAAKVDKPSRKLRKERKNRAKKFRGTKKSKAAEPPKKGKBasic
NLS Segment(s)
PositionSequence
95-134GLAAKVDKPSRKLRKERKNRAKKFRGTKKSKAAEPPKKGK
Subcellular Location(s) mito 21, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences DSAPITLRTRKFITNRLLARRQFVLDVLHPSRPNVSKAELSEKLAALYKTQKERVVTFGFRTHFGGGRSTGFALIYDDEASQKKFEPKYRLVRSGLAAKVDKPSRKLRKERKNRAKKFRGTKKSKAAEPPKKGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.61
3 0.64
4 0.69
5 0.64
6 0.62
7 0.57
8 0.5
9 0.42
10 0.35
11 0.3
12 0.24
13 0.3
14 0.28
15 0.31
16 0.29
17 0.29
18 0.33
19 0.32
20 0.31
21 0.26
22 0.27
23 0.26
24 0.28
25 0.35
26 0.31
27 0.31
28 0.31
29 0.29
30 0.26
31 0.25
32 0.23
33 0.17
34 0.21
35 0.23
36 0.26
37 0.29
38 0.31
39 0.3
40 0.31
41 0.35
42 0.33
43 0.3
44 0.27
45 0.29
46 0.27
47 0.26
48 0.27
49 0.22
50 0.19
51 0.19
52 0.18
53 0.14
54 0.14
55 0.13
56 0.12
57 0.11
58 0.09
59 0.08
60 0.07
61 0.07
62 0.06
63 0.06
64 0.06
65 0.08
66 0.09
67 0.1
68 0.09
69 0.11
70 0.17
71 0.21
72 0.27
73 0.33
74 0.4
75 0.5
76 0.56
77 0.6
78 0.57
79 0.55
80 0.51
81 0.51
82 0.44
83 0.38
84 0.32
85 0.27
86 0.33
87 0.36
88 0.37
89 0.35
90 0.44
91 0.5
92 0.59
93 0.69
94 0.72
95 0.78
96 0.86
97 0.92
98 0.93
99 0.94
100 0.95
101 0.95
102 0.95
103 0.93
104 0.93
105 0.93
106 0.93
107 0.9
108 0.9
109 0.89
110 0.87
111 0.85
112 0.84
113 0.84
114 0.84