Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L6WJ19

Protein Details
Accession A0A0L6WJ19    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-40MANPRQRRKARSSSHKAVSHSRHAKRNLKKMPPIRGPKILHydrophilic
NLS Segment(s)
PositionSequence
5-38RQRRKARSSSHKAVSHSRHAKRNLKKMPPIRGPK
Subcellular Location(s) nucl 14, mito 10, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019002  Ribosome_biogenesis_Nop16  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF09420  Nop16  
Amino Acid Sequences MANPRQRRKARSSSHKAVSHSRHAKRNLKKMPPIRGPKILQDAWDKTKTVRQNYIALGLVHDLNPTASGGSERIEVRSQIEESQIASTSQLESAPPIPKGFGKIIRDDAGNVLRIELPQDDSETRTEKRQDESLHEPEVDGAVLGPWVTDLGGGTKIKMSNGDGNVVRALERISKVVQQNGTTLEIPLSGSGGRHVSAGEMAYLGRLVEKYGEDVSKMARDRRLNAEQRTAGALGRALKKAGLIGRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.82
3 0.78
4 0.77
5 0.73
6 0.73
7 0.73
8 0.7
9 0.7
10 0.74
11 0.79
12 0.79
13 0.83
14 0.82
15 0.81
16 0.84
17 0.83
18 0.84
19 0.85
20 0.85
21 0.8
22 0.79
23 0.72
24 0.69
25 0.69
26 0.59
27 0.53
28 0.51
29 0.5
30 0.48
31 0.48
32 0.42
33 0.36
34 0.42
35 0.45
36 0.44
37 0.46
38 0.42
39 0.45
40 0.45
41 0.47
42 0.42
43 0.35
44 0.29
45 0.22
46 0.2
47 0.14
48 0.13
49 0.09
50 0.07
51 0.07
52 0.07
53 0.06
54 0.05
55 0.06
56 0.06
57 0.07
58 0.1
59 0.1
60 0.12
61 0.13
62 0.14
63 0.15
64 0.17
65 0.17
66 0.15
67 0.16
68 0.14
69 0.14
70 0.14
71 0.13
72 0.1
73 0.1
74 0.09
75 0.08
76 0.08
77 0.08
78 0.06
79 0.07
80 0.11
81 0.13
82 0.13
83 0.13
84 0.13
85 0.13
86 0.17
87 0.18
88 0.21
89 0.21
90 0.23
91 0.25
92 0.26
93 0.25
94 0.23
95 0.22
96 0.18
97 0.17
98 0.14
99 0.12
100 0.11
101 0.11
102 0.11
103 0.09
104 0.09
105 0.08
106 0.09
107 0.09
108 0.1
109 0.12
110 0.14
111 0.14
112 0.16
113 0.2
114 0.2
115 0.22
116 0.26
117 0.26
118 0.28
119 0.35
120 0.34
121 0.32
122 0.3
123 0.27
124 0.23
125 0.21
126 0.15
127 0.08
128 0.05
129 0.03
130 0.03
131 0.03
132 0.03
133 0.02
134 0.02
135 0.02
136 0.02
137 0.03
138 0.04
139 0.07
140 0.08
141 0.08
142 0.1
143 0.11
144 0.11
145 0.12
146 0.14
147 0.16
148 0.17
149 0.21
150 0.2
151 0.2
152 0.21
153 0.19
154 0.17
155 0.11
156 0.12
157 0.11
158 0.11
159 0.12
160 0.13
161 0.18
162 0.21
163 0.25
164 0.27
165 0.24
166 0.25
167 0.25
168 0.27
169 0.22
170 0.2
171 0.15
172 0.13
173 0.12
174 0.1
175 0.09
176 0.06
177 0.06
178 0.08
179 0.08
180 0.08
181 0.08
182 0.08
183 0.08
184 0.09
185 0.09
186 0.08
187 0.07
188 0.06
189 0.06
190 0.06
191 0.06
192 0.06
193 0.06
194 0.06
195 0.08
196 0.08
197 0.11
198 0.14
199 0.14
200 0.14
201 0.15
202 0.17
203 0.21
204 0.25
205 0.27
206 0.31
207 0.35
208 0.39
209 0.47
210 0.55
211 0.57
212 0.59
213 0.64
214 0.58
215 0.55
216 0.53
217 0.45
218 0.36
219 0.28
220 0.26
221 0.23
222 0.26
223 0.26
224 0.24
225 0.23
226 0.23
227 0.27