Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6WUK8

Protein Details
Accession A0A0L6WUK8    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
108-132SKVLGVNLKKKRKAKEHPPALQTQSHydrophilic
NLS Segment(s)
PositionSequence
116-123KKKRKAKE
Subcellular Location(s) nucl 11, mito 10, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021109  Peptidase_aspartic_dom_sf  
Amino Acid Sequences LVLHYKDHSEQATFAVTSLGKQDIILGFTWLCKHNSEIDWTKSEVKMSLCPHCCTTCAEEAHKLHRTKVCEHAAMCACHAGHLPYVDLDLLYPPLWHSLLERPSTRMSKVLGVNLKKKRKAKEHPPALQTQSLQMKPLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.14
4 0.13
5 0.15
6 0.14
7 0.11
8 0.11
9 0.13
10 0.12
11 0.13
12 0.13
13 0.12
14 0.11
15 0.12
16 0.15
17 0.14
18 0.15
19 0.14
20 0.16
21 0.19
22 0.21
23 0.27
24 0.3
25 0.31
26 0.33
27 0.34
28 0.35
29 0.31
30 0.3
31 0.26
32 0.21
33 0.24
34 0.25
35 0.3
36 0.31
37 0.32
38 0.34
39 0.32
40 0.31
41 0.28
42 0.28
43 0.25
44 0.24
45 0.24
46 0.28
47 0.29
48 0.33
49 0.38
50 0.35
51 0.33
52 0.35
53 0.36
54 0.33
55 0.4
56 0.37
57 0.32
58 0.32
59 0.33
60 0.33
61 0.3
62 0.27
63 0.2
64 0.17
65 0.15
66 0.15
67 0.1
68 0.08
69 0.08
70 0.08
71 0.07
72 0.07
73 0.07
74 0.06
75 0.06
76 0.05
77 0.06
78 0.06
79 0.06
80 0.06
81 0.07
82 0.08
83 0.08
84 0.1
85 0.15
86 0.2
87 0.24
88 0.25
89 0.26
90 0.32
91 0.34
92 0.33
93 0.29
94 0.27
95 0.29
96 0.3
97 0.34
98 0.36
99 0.4
100 0.48
101 0.55
102 0.62
103 0.64
104 0.69
105 0.71
106 0.74
107 0.79
108 0.81
109 0.83
110 0.85
111 0.85
112 0.84
113 0.82
114 0.76
115 0.7
116 0.59
117 0.56
118 0.54
119 0.46